BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10o07 (318 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z48055-3|CAH04721.1| 35|Caenorhabditis elegans Hypothetical pr... 48 2e-06 U23168-3|AAU87831.1| 4034|Caenorhabditis elegans Temporarily ass... 27 3.9 U23168-1|AAU87832.1| 7548|Caenorhabditis elegans Temporarily ass... 27 3.9 AF039052-10|AAF98634.1| 536|Caenorhabditis elegans Hypothetical... 27 3.9 Z75549-4|CAA99919.2| 304|Caenorhabditis elegans Hypothetical pr... 26 5.1 U28993-8|AAK31496.1| 632|Caenorhabditis elegans C.elegans homeo... 25 8.9 U28993-7|AAL27244.1| 641|Caenorhabditis elegans C.elegans homeo... 25 8.9 >Z48055-3|CAH04721.1| 35|Caenorhabditis elegans Hypothetical protein T07A5.5 protein. Length = 35 Score = 47.6 bits (108), Expect = 2e-06 Identities = 17/31 (54%), Positives = 28/31 (90%) Frame = +3 Query: 93 MITDIQLAVFSNILGVSIFLLVILYHYINAN 185 MI+D+QL + +NILG+++ +LV+L+HY+NAN Sbjct: 1 MISDVQLGIAANILGIAMLMLVVLFHYLNAN 31 >U23168-3|AAU87831.1| 4034|Caenorhabditis elegans Temporarily assigned gene nameprotein 308, isoform b protein. Length = 4034 Score = 26.6 bits (56), Expect = 3.9 Identities = 14/33 (42%), Positives = 22/33 (66%) Frame = +3 Query: 42 LIHNFNNLIQFKTSNLKMITDIQLAVFSNILGV 140 +I + N+ I S L MI++ + A+FSNI+GV Sbjct: 2360 VISSLNSTITSDAS-LDMISESEQAIFSNIIGV 2391 >U23168-1|AAU87832.1| 7548|Caenorhabditis elegans Temporarily assigned gene nameprotein 308, isoform c protein. Length = 7548 Score = 26.6 bits (56), Expect = 3.9 Identities = 14/33 (42%), Positives = 22/33 (66%) Frame = +3 Query: 42 LIHNFNNLIQFKTSNLKMITDIQLAVFSNILGV 140 +I + N+ I S L MI++ + A+FSNI+GV Sbjct: 2360 VISSLNSTITSDAS-LDMISESEQAIFSNIIGV 2391 >AF039052-10|AAF98634.1| 536|Caenorhabditis elegans Hypothetical protein T22D1.1 protein. Length = 536 Score = 26.6 bits (56), Expect = 3.9 Identities = 22/65 (33%), Positives = 33/65 (50%), Gaps = 3/65 (4%) Frame = +3 Query: 3 PVSTRIQKNLNTKLIHNFNNLI-QFKTSNLK--MITDIQLAVFSNILGVSIFLLVILYHY 173 PVS ++K+ NT+ N N I + K S K +I D Q + S +L VS + Y+Y Sbjct: 10 PVSQLLKKSSNTRTSENTTNYISRIKNSIPKSGVIIDPQRRL-SRVLPVSHVFITSAYYY 68 Query: 174 INANS 188 + S Sbjct: 69 PTSKS 73 >Z75549-4|CAA99919.2| 304|Caenorhabditis elegans Hypothetical protein T19C4.4 protein. Length = 304 Score = 26.2 bits (55), Expect = 5.1 Identities = 11/36 (30%), Positives = 18/36 (50%) Frame = +3 Query: 27 NLNTKLIHNFNNLIQFKTSNLKMITDIQLAVFSNIL 134 N+NT + N I F + L ++ L FSN++ Sbjct: 241 NMNTSMAVTLANFIPFISDGLSLVQPWLLVTFSNVM 276 >U28993-8|AAK31496.1| 632|Caenorhabditis elegans C.elegans homeobox protein 38,isoform a protein. Length = 632 Score = 25.4 bits (53), Expect = 8.9 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = -1 Query: 177 LCSDTG*LIRIWRLPKCWRKLRAG 106 LC G L + R PK W KL++G Sbjct: 336 LCRSQGTLSDLLRNPKPWNKLKSG 359 >U28993-7|AAL27244.1| 641|Caenorhabditis elegans C.elegans homeobox protein 38,isoform b protein. Length = 641 Score = 25.4 bits (53), Expect = 8.9 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = -1 Query: 177 LCSDTG*LIRIWRLPKCWRKLRAG 106 LC G L + R PK W KL++G Sbjct: 345 LCRSQGTLSDLLRNPKPWNKLKSG 368 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,185,207 Number of Sequences: 27780 Number of extensions: 108918 Number of successful extensions: 244 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 238 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 244 length of database: 12,740,198 effective HSP length: 71 effective length of database: 10,767,818 effective search space used: 366105812 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -