BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10o06 (553 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC110058-1|AAI10059.1| 518|Homo sapiens leucine rich repeat tra... 30 4.7 BC099738-1|AAH99738.1| 518|Homo sapiens leucine rich repeat tra... 30 4.7 BC098301-1|AAH98301.1| 519|Homo sapiens LRRTM4 protein protein. 30 4.7 BC098267-1|AAH98267.1| 519|Homo sapiens LRRTM4 protein protein. 30 4.7 AY358324-1|AAQ88690.1| 590|Homo sapiens GFHL3075 protein. 30 4.7 AY182030-1|AAO67551.1| 518|Homo sapiens leucine-rich repeat tra... 30 4.7 AK126961-1|BAC86764.1| 518|Homo sapiens protein ( Homo sapiens ... 30 4.7 BC113717-1|AAI13718.1| 581|Homo sapiens leucine rich repeat tra... 29 8.2 BC113715-1|AAI13716.1| 581|Homo sapiens leucine rich repeat tra... 29 8.2 BC111492-1|AAI11493.1| 581|Homo sapiens leucine rich repeat tra... 29 8.2 AY358315-1|AAQ88681.1| 513|Homo sapiens GFNV803 protein. 29 8.2 AY182028-1|AAO67549.1| 513|Homo sapiens leucine-rich repeat tra... 29 8.2 >BC110058-1|AAI10059.1| 518|Homo sapiens leucine rich repeat transmembrane neuronal 4 protein. Length = 518 Score = 30.3 bits (65), Expect = 4.7 Identities = 17/36 (47%), Positives = 26/36 (72%), Gaps = 4/36 (11%) Frame = +2 Query: 125 LHLRSNNIQTVMVHSY---GNFDPLEL-YHRLRNIS 220 LHLRSN+++TV + + N D L+L Y+RLR++S Sbjct: 162 LHLRSNSLKTVPIRVFQDCRNLDFLDLGYNRLRSLS 197 >BC099738-1|AAH99738.1| 518|Homo sapiens leucine rich repeat transmembrane neuronal 4 protein. Length = 518 Score = 30.3 bits (65), Expect = 4.7 Identities = 17/36 (47%), Positives = 26/36 (72%), Gaps = 4/36 (11%) Frame = +2 Query: 125 LHLRSNNIQTVMVHSY---GNFDPLEL-YHRLRNIS 220 LHLRSN+++TV + + N D L+L Y+RLR++S Sbjct: 162 LHLRSNSLKTVPIRVFQDCRNLDFLDLGYNRLRSLS 197 >BC098301-1|AAH98301.1| 519|Homo sapiens LRRTM4 protein protein. Length = 519 Score = 30.3 bits (65), Expect = 4.7 Identities = 17/36 (47%), Positives = 26/36 (72%), Gaps = 4/36 (11%) Frame = +2 Query: 125 LHLRSNNIQTVMVHSY---GNFDPLEL-YHRLRNIS 220 LHLRSN+++TV + + N D L+L Y+RLR++S Sbjct: 163 LHLRSNSLKTVPIRVFQDCRNLDFLDLGYNRLRSLS 198 >BC098267-1|AAH98267.1| 519|Homo sapiens LRRTM4 protein protein. Length = 519 Score = 30.3 bits (65), Expect = 4.7 Identities = 17/36 (47%), Positives = 26/36 (72%), Gaps = 4/36 (11%) Frame = +2 Query: 125 LHLRSNNIQTVMVHSY---GNFDPLEL-YHRLRNIS 220 LHLRSN+++TV + + N D L+L Y+RLR++S Sbjct: 163 LHLRSNSLKTVPIRVFQDCRNLDFLDLGYNRLRSLS 198 >AY358324-1|AAQ88690.1| 590|Homo sapiens GFHL3075 protein. Length = 590 Score = 30.3 bits (65), Expect = 4.7 Identities = 17/36 (47%), Positives = 26/36 (72%), Gaps = 4/36 (11%) Frame = +2 Query: 125 LHLRSNNIQTVMVHSY---GNFDPLEL-YHRLRNIS 220 LHLRSN+++TV + + N D L+L Y+RLR++S Sbjct: 162 LHLRSNSLKTVPIRVFQDCRNLDFLDLGYNRLRSLS 197 >AY182030-1|AAO67551.1| 518|Homo sapiens leucine-rich repeat transmembrane neuronal 4 protein protein. Length = 518 Score = 30.3 bits (65), Expect = 4.7 Identities = 17/36 (47%), Positives = 26/36 (72%), Gaps = 4/36 (11%) Frame = +2 Query: 125 LHLRSNNIQTVMVHSY---GNFDPLEL-YHRLRNIS 220 LHLRSN+++TV + + N D L+L Y+RLR++S Sbjct: 162 LHLRSNSLKTVPIRVFQDCRNLDFLDLGYNRLRSLS 197 >AK126961-1|BAC86764.1| 518|Homo sapiens protein ( Homo sapiens cDNA FLJ45014 fis, clone BRAWH3014609. ). Length = 518 Score = 30.3 bits (65), Expect = 4.7 Identities = 17/36 (47%), Positives = 26/36 (72%), Gaps = 4/36 (11%) Frame = +2 Query: 125 LHLRSNNIQTVMVHSY---GNFDPLEL-YHRLRNIS 220 LHLRSN+++TV + + N D L+L Y+RLR++S Sbjct: 162 LHLRSNSLKTVPIRVFQDCRNLDFLDLGYNRLRSLS 197 >BC113717-1|AAI13718.1| 581|Homo sapiens leucine rich repeat transmembrane neuronal 3 protein. Length = 581 Score = 29.5 bits (63), Expect = 8.2 Identities = 15/37 (40%), Positives = 26/37 (70%), Gaps = 4/37 (10%) Frame = +2 Query: 122 SLHLRSNNIQTVMVHSYGNFDPLEL----YHRLRNIS 220 SLHLRSN+++T+ V + + LEL Y+R+R+++ Sbjct: 161 SLHLRSNSLRTIPVRIFQDCRNLELLDLGYNRIRSLA 197 >BC113715-1|AAI13716.1| 581|Homo sapiens leucine rich repeat transmembrane neuronal 3 protein. Length = 581 Score = 29.5 bits (63), Expect = 8.2 Identities = 15/37 (40%), Positives = 26/37 (70%), Gaps = 4/37 (10%) Frame = +2 Query: 122 SLHLRSNNIQTVMVHSYGNFDPLEL----YHRLRNIS 220 SLHLRSN+++T+ V + + LEL Y+R+R+++ Sbjct: 161 SLHLRSNSLRTIPVRIFQDCRNLELLDLGYNRIRSLA 197 >BC111492-1|AAI11493.1| 581|Homo sapiens leucine rich repeat transmembrane neuronal 3 protein. Length = 581 Score = 29.5 bits (63), Expect = 8.2 Identities = 15/37 (40%), Positives = 26/37 (70%), Gaps = 4/37 (10%) Frame = +2 Query: 122 SLHLRSNNIQTVMVHSYGNFDPLEL----YHRLRNIS 220 SLHLRSN+++T+ V + + LEL Y+R+R+++ Sbjct: 161 SLHLRSNSLRTIPVRIFQDCRNLELLDLGYNRIRSLA 197 >AY358315-1|AAQ88681.1| 513|Homo sapiens GFNV803 protein. Length = 513 Score = 29.5 bits (63), Expect = 8.2 Identities = 15/37 (40%), Positives = 26/37 (70%), Gaps = 4/37 (10%) Frame = +2 Query: 122 SLHLRSNNIQTVMVHSYGNFDPLEL----YHRLRNIS 220 SLHLRSN+++T+ V + + LEL Y+R+R+++ Sbjct: 161 SLHLRSNSLRTIPVRIFQDCRNLELLDLGYNRIRSLA 197 >AY182028-1|AAO67549.1| 513|Homo sapiens leucine-rich repeat transmembrane neuronal 3 protein protein. Length = 513 Score = 29.5 bits (63), Expect = 8.2 Identities = 15/37 (40%), Positives = 26/37 (70%), Gaps = 4/37 (10%) Frame = +2 Query: 122 SLHLRSNNIQTVMVHSYGNFDPLEL----YHRLRNIS 220 SLHLRSN+++T+ V + + LEL Y+R+R+++ Sbjct: 161 SLHLRSNSLRTIPVRIFQDCRNLELLDLGYNRIRSLA 197 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 74,956,229 Number of Sequences: 237096 Number of extensions: 1596700 Number of successful extensions: 6016 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 5966 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6016 length of database: 76,859,062 effective HSP length: 86 effective length of database: 56,468,806 effective search space used: 5477474182 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -