BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10o04 (397 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_03_0131 + 8779006-8779073,8779517-8779662,8779739-8780794,878... 29 1.8 05_05_0251 + 23616546-23617760 28 2.4 >05_03_0131 + 8779006-8779073,8779517-8779662,8779739-8780794, 8781070-8781232,8781423-8781494,8782076-8782147, 8782643-8782815,8782958-8783163,8783277-8783403, 8783793-8783864,8783984-8784176,8784298-8784768, 8785635-8785740 Length = 974 Score = 28.7 bits (61), Expect = 1.8 Identities = 14/39 (35%), Positives = 22/39 (56%) Frame = -2 Query: 303 DKVTDLNVLACIVVSNQPSLHTVDVSHPYRDLLAQYPDI 187 D T+L +A + +N +HTVDV + RDL +Y + Sbjct: 88 DFKTNLTYVADVGFTNTGFIHTVDVGNLQRDLAQRYTTV 126 >05_05_0251 + 23616546-23617760 Length = 404 Score = 28.3 bits (60), Expect = 2.4 Identities = 11/45 (24%), Positives = 21/45 (46%) Frame = -2 Query: 243 HTVDVSHPYRDLLAQYPDITKPASFKEVSSHNVLHYIETTGPPVH 109 H + + +PY ++ P ++ + + HY + TGP VH Sbjct: 118 HRLRIPYPYVSWATVAATLSSPPENEDCLAAAICHYCQETGPRVH 162 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,181,136 Number of Sequences: 37544 Number of extensions: 158020 Number of successful extensions: 353 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 350 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 353 length of database: 14,793,348 effective HSP length: 74 effective length of database: 12,015,092 effective search space used: 684860244 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -