BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10n15 (702 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC3A11.08 |pcu4|cul4, Cul-4|cullin 4|Schizosaccharomyces pombe... 27 3.4 SPAC732.02c |||fructose-2,6-bisphosphate 2-phosphatase activity ... 26 6.0 >SPAC3A11.08 |pcu4|cul4, Cul-4|cullin 4|Schizosaccharomyces pombe|chr 1|||Manual Length = 734 Score = 26.6 bits (56), Expect = 3.4 Identities = 14/37 (37%), Positives = 24/37 (64%) Frame = +3 Query: 3 TSHLDTA*KTCNSFIKKYEDNNCIMV*KCSSNLQYNY 113 TSHLDT K + FI+K + ++C ++ + LQ+N+ Sbjct: 268 TSHLDTLTKGISQFIEKRDAHSCKLL---YALLQFNH 301 >SPAC732.02c |||fructose-2,6-bisphosphate 2-phosphatase activity |Schizosaccharomyces pombe|chr 1|||Manual Length = 408 Score = 25.8 bits (54), Expect = 6.0 Identities = 11/33 (33%), Positives = 15/33 (45%) Frame = -1 Query: 702 CYHLXHFHLFLYISPFNNIFSNFTAFLLHYTPL 604 C H +F F + N I + + HYTPL Sbjct: 132 CQHSPYFKSFPFEESKNKILDSIHEYEKHYTPL 164 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,404,186 Number of Sequences: 5004 Number of extensions: 45492 Number of successful extensions: 93 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 90 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 93 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 325165428 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -