BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10n15 (702 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. 23 2.8 EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. 23 2.8 AB072429-1|BAB83990.1| 388|Apis mellifera IP3phosphatase protein. 21 8.6 >EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. Length = 684 Score = 23.0 bits (47), Expect = 2.8 Identities = 7/19 (36%), Positives = 14/19 (73%) Frame = -1 Query: 684 FHLFLYISPFNNIFSNFTA 628 F LFLY+SP ++ ++ + + Sbjct: 616 FQLFLYVSPVSSEYNQYNS 634 >EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. Length = 684 Score = 23.0 bits (47), Expect = 2.8 Identities = 7/19 (36%), Positives = 14/19 (73%) Frame = -1 Query: 684 FHLFLYISPFNNIFSNFTA 628 F LFLY+SP ++ ++ + + Sbjct: 616 FQLFLYVSPVSSEYNQYNS 634 >AB072429-1|BAB83990.1| 388|Apis mellifera IP3phosphatase protein. Length = 388 Score = 21.4 bits (43), Expect = 8.6 Identities = 9/31 (29%), Positives = 19/31 (61%) Frame = +1 Query: 271 TMETKLFVKIFLSNQYVMNLMKIKPFKTENY 363 T + + FV++ +S++ + KI+ F E+Y Sbjct: 61 TRQVEDFVRLLMSSEELRLFDKIRVFLDEDY 91 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 163,852 Number of Sequences: 438 Number of extensions: 3405 Number of successful extensions: 7 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21561255 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -