BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10n15 (702 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g27940.1 68414.m03423 multidrug resistance P-glycoprotein, pu... 28 5.2 At1g04860.1 68414.m00482 ubiquitin-specific protease 2 (UBP2) id... 28 6.9 At3g55790.1 68416.m06199 expressed protein predicted protein, Ar... 27 9.1 >At1g27940.1 68414.m03423 multidrug resistance P-glycoprotein, putative similar to mdr-like P-glycoprotein atpgp1 GI:3849833 from [Arabidopsis thaliana] Length = 1245 Score = 28.3 bits (60), Expect = 5.2 Identities = 15/42 (35%), Positives = 24/42 (57%) Frame = +2 Query: 347 SKQKIIIRA*DKVMKGRTLT*VTNKDNREDEVDEVRAGARGR 472 S +K++ A DK+MKGRT V ++ + + D V +GR Sbjct: 1176 SSEKLVQEALDKLMKGRTTVLVAHRLSTIRKADTVAVLHKGR 1217 >At1g04860.1 68414.m00482 ubiquitin-specific protease 2 (UBP2) identical to GI:11993463 Length = 961 Score = 27.9 bits (59), Expect = 6.9 Identities = 12/34 (35%), Positives = 21/34 (61%) Frame = -3 Query: 184 DGYILKGLGSVGDEGLFKNTTASL*LYCRLLEHF 83 DGY+++GL ++G+ F + +L RL +HF Sbjct: 226 DGYVVRGLVNLGNTCFFNSIMQNLLSLDRLRDHF 259 >At3g55790.1 68416.m06199 expressed protein predicted protein, Arabidopsis thaliana; expression supported by MPSS Length = 103 Score = 27.5 bits (58), Expect = 9.1 Identities = 10/16 (62%), Positives = 13/16 (81%) Frame = -2 Query: 353 VLNGFIFIKFITYWLL 306 VL F+F+ FI+YWLL Sbjct: 87 VLQSFLFMVFISYWLL 102 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,976,641 Number of Sequences: 28952 Number of extensions: 219301 Number of successful extensions: 455 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 444 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 455 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1506636208 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -