BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10n11 (467 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U97669-1|AAB91371.1| 2321|Homo sapiens Notch3 protein. 30 3.5 AF058900-1|AAC14346.1| 2321|Homo sapiens Notch3 protein. 30 3.5 AC004663-1|AAC15789.1| 2281|Homo sapiens Notch 3 protein. 30 3.5 >U97669-1|AAB91371.1| 2321|Homo sapiens Notch3 protein. Length = 2321 Score = 30.3 bits (65), Expect = 3.5 Identities = 15/46 (32%), Positives = 23/46 (50%) Frame = +2 Query: 203 HQCCWFPPGQTVDRRGSSGCKSRHKPPRQDLDRAQQSHKRDSPAGK 340 H WFP G ++ + +SG K R +P QD + K +S G+ Sbjct: 1671 HSTLWFPEGFSLHKDVASGHKGRREPVGQDALGMKNMAKGESLMGE 1716 >AF058900-1|AAC14346.1| 2321|Homo sapiens Notch3 protein. Length = 2321 Score = 30.3 bits (65), Expect = 3.5 Identities = 15/46 (32%), Positives = 23/46 (50%) Frame = +2 Query: 203 HQCCWFPPGQTVDRRGSSGCKSRHKPPRQDLDRAQQSHKRDSPAGK 340 H WFP G ++ + +SG K R +P QD + K +S G+ Sbjct: 1671 HSTLWFPEGFSLHKDVASGHKGRREPVGQDALGMKNMAKGESLMGE 1716 >AC004663-1|AAC15789.1| 2281|Homo sapiens Notch 3 protein. Length = 2281 Score = 30.3 bits (65), Expect = 3.5 Identities = 15/46 (32%), Positives = 23/46 (50%) Frame = +2 Query: 203 HQCCWFPPGQTVDRRGSSGCKSRHKPPRQDLDRAQQSHKRDSPAGK 340 H WFP G ++ + +SG K R +P QD + K +S G+ Sbjct: 1631 HSTLWFPEGFSLHKDVASGHKGRREPVGQDALGMKNMAKGESLMGE 1676 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 64,625,373 Number of Sequences: 237096 Number of extensions: 1415571 Number of successful extensions: 3633 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3494 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3632 length of database: 76,859,062 effective HSP length: 84 effective length of database: 56,942,998 effective search space used: 4042952858 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -