BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10n09 (659 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 25 0.85 AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein... 23 3.4 DQ435324-1|ABD92639.1| 152|Apis mellifera OBP3 protein. 21 7.9 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 24.6 bits (51), Expect = 0.85 Identities = 14/44 (31%), Positives = 21/44 (47%) Frame = +3 Query: 522 PHSTLYYERLRVVIINPIKNMYLESTDVYREKRTRLSAPCALRL 653 PHSTL Y+ ++ P K +S D +E T +A A + Sbjct: 1072 PHSTLEYKVKERHLMRPRKRDQKQSDDKTKETSTVTAAAAATNI 1115 >AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein protein. Length = 411 Score = 22.6 bits (46), Expect = 3.4 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = -2 Query: 217 AFDSIGEWVECVEILDGHTIER 152 A SI E+ E+L HT+E+ Sbjct: 259 AMSSIAEFSVSTEVLQDHTLEK 280 >DQ435324-1|ABD92639.1| 152|Apis mellifera OBP3 protein. Length = 152 Score = 21.4 bits (43), Expect = 7.9 Identities = 8/28 (28%), Positives = 17/28 (60%) Frame = -3 Query: 90 DNALLCAR*QTANLC*LQNVMADETRKM 7 D+ LC + + NL + +++ DE+ +M Sbjct: 22 DDITLCLKQENLNLDDIDSLLEDESERM 49 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 184,897 Number of Sequences: 438 Number of extensions: 3792 Number of successful extensions: 8 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 19855845 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -