BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10n09 (659 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g54290.1 68414.m06189 eukaryotic translation initiation facto... 131 5e-31 At4g27130.1 68417.m03899 eukaryotic translation initiation facto... 129 2e-30 At5g54760.1 68418.m06820 eukaryotic translation initiation facto... 128 2e-30 At5g54940.2 68418.m06843 eukaryotic translation initiation facto... 124 5e-29 At5g54940.1 68418.m06842 eukaryotic translation initiation facto... 124 5e-29 At5g11900.1 68418.m01392 eukaryotic translation initiation facto... 35 0.042 At1g05530.1 68414.m00567 UDP-glucoronosyl/UDP-glucosyl transfera... 34 0.096 At5g49130.1 68418.m06081 MATE efflux family protein contains Pfa... 30 1.2 At2g15345.1 68415.m01755 expressed protein 30 1.6 At1g63430.1 68414.m07173 leucine-rich repeat transmembrane prote... 28 6.3 At5g04780.1 68418.m00494 SEC14 cytosolic factor-related contains... 27 8.4 At1g75990.1 68414.m08824 26S proteasome regulatory subunit S3, p... 27 8.4 At1g27900.1 68414.m03419 RNA helicase, putative similar to SP|Q1... 27 8.4 >At1g54290.1 68414.m06189 eukaryotic translation initiation factor SUI1, putative similar to P|P32911 Protein translation factor SUI1 {Saccharomyces cerevisiae}; contains Pfam profile PF01253: Translation initiation factor SUI1 Length = 113 Score = 131 bits (316), Expect = 5e-31 Identities = 59/110 (53%), Positives = 77/110 (70%) Frame = +2 Query: 164 MSIQNLNTFDPFADAIKSSEDDVQDGLVHVRIQQRNGRKTLTTVQGLSSEYDLKKIVRAC 343 + +Q FDPFADA VH+R+QQRNGRK+LTTVQGL EY KI++ Sbjct: 4 LEVQVPTAFDPFADANAEDSGAGTKEYVHIRVQQRNGRKSLTTVQGLKKEYSYSKILKDL 63 Query: 344 KKEFACNGTVVEHPEYGEVLQLQGDQRENICQWLTKSGLVKPEQLKVHGF 493 KKEF CNGTVV+ E G+V+QLQGDQR+N+ +L ++GLVK + +K+HGF Sbjct: 64 KKEFCCNGTVVQDSELGQVIQLQGDQRKNVSTFLVQAGLVKKDNIKIHGF 113 >At4g27130.1 68417.m03899 eukaryotic translation initiation factor SUI1, putative similar to SP|P32911 Protein translation factor SUI1 {Saccharomyces cerevisiae}; contains Pfam profile PF01253: Translation initiation factor SUI1 Length = 113 Score = 129 bits (311), Expect = 2e-30 Identities = 58/102 (56%), Positives = 74/102 (72%) Frame = +2 Query: 188 FDPFADAIKSSEDDVQDGLVHVRIQQRNGRKTLTTVQGLSSEYDLKKIVRACKKEFACNG 367 FDPFADA VH+R+QQRNGRK+LTTVQGL EY KI++ KKEF CNG Sbjct: 12 FDPFADANAEDSGAGTKEYVHIRVQQRNGRKSLTTVQGLKKEYSYTKILKDLKKEFCCNG 71 Query: 368 TVVEHPEYGEVLQLQGDQRENICQWLTKSGLVKPEQLKVHGF 493 TVV+ E G+V+QLQGDQR+N+ +L ++GLVK + +K+HGF Sbjct: 72 TVVQDSELGQVIQLQGDQRKNVSTFLVQAGLVKKDNIKIHGF 113 >At5g54760.1 68418.m06820 eukaryotic translation initiation factor SUI1, putative similar to SP|P32911 Protein translation factor SUI1 {Saccharomyces cerevisiae}; contains Pfam profile PF01253: Translation initiation factor SUI1 Length = 113 Score = 128 bits (310), Expect = 2e-30 Identities = 58/102 (56%), Positives = 74/102 (72%) Frame = +2 Query: 188 FDPFADAIKSSEDDVQDGLVHVRIQQRNGRKTLTTVQGLSSEYDLKKIVRACKKEFACNG 367 FDPFADA VH+R+QQRNGRK+LTTVQGL EY KI++ KKEF CNG Sbjct: 12 FDPFADANVEDSGAGTKEYVHIRVQQRNGRKSLTTVQGLKKEYSYTKILKDLKKEFCCNG 71 Query: 368 TVVEHPEYGEVLQLQGDQRENICQWLTKSGLVKPEQLKVHGF 493 TVV+ E G+V+QLQGDQR+N+ +L ++GLVK + +K+HGF Sbjct: 72 TVVQDSELGQVIQLQGDQRKNVSTFLVQAGLVKKDNIKIHGF 113 >At5g54940.2 68418.m06843 eukaryotic translation initiation factor SUI1, putative similar to SP|P32911 Protein translation factor SUI1 {Saccharomyces cerevisiae}; contains Pfam profile PF01253: Translation initiation factor SUI1 Length = 112 Score = 124 bits (299), Expect = 5e-29 Identities = 53/110 (48%), Positives = 81/110 (73%) Frame = +2 Query: 164 MSIQNLNTFDPFADAIKSSEDDVQDGLVHVRIQQRNGRKTLTTVQGLSSEYDLKKIVRAC 343 + IQ + +DPFA+A S ++ +H+RIQQRNG+K+LTTVQGL EY ++I++ Sbjct: 4 LDIQIPSAYDPFAEAKDSDAPGAKEN-IHIRIQQRNGKKSLTTVQGLKKEYSYERILKDL 62 Query: 344 KKEFACNGTVVEHPEYGEVLQLQGDQRENICQWLTKSGLVKPEQLKVHGF 493 KK+F CNG VV+ E G+++QLQGDQR+ + Q+L ++G+ K +Q+K+HGF Sbjct: 63 KKDFCCNGNVVQDKELGKIIQLQGDQRKKVSQFLVQTGIAKKDQIKIHGF 112 >At5g54940.1 68418.m06842 eukaryotic translation initiation factor SUI1, putative similar to SP|P32911 Protein translation factor SUI1 {Saccharomyces cerevisiae}; contains Pfam profile PF01253: Translation initiation factor SUI1 Length = 112 Score = 124 bits (299), Expect = 5e-29 Identities = 53/110 (48%), Positives = 81/110 (73%) Frame = +2 Query: 164 MSIQNLNTFDPFADAIKSSEDDVQDGLVHVRIQQRNGRKTLTTVQGLSSEYDLKKIVRAC 343 + IQ + +DPFA+A S ++ +H+RIQQRNG+K+LTTVQGL EY ++I++ Sbjct: 4 LDIQIPSAYDPFAEAKDSDAPGAKEN-IHIRIQQRNGKKSLTTVQGLKKEYSYERILKDL 62 Query: 344 KKEFACNGTVVEHPEYGEVLQLQGDQRENICQWLTKSGLVKPEQLKVHGF 493 KK+F CNG VV+ E G+++QLQGDQR+ + Q+L ++G+ K +Q+K+HGF Sbjct: 63 KKDFCCNGNVVQDKELGKIIQLQGDQRKKVSQFLVQTGIAKKDQIKIHGF 112 >At5g11900.1 68418.m01392 eukaryotic translation initiation factor SUI1 family protein similar to SP|O43583 Density-regulated protein (DRP1 protein) (Smooth muscle cell associated protein-3) {Homo sapiens}; contains Pfam profile PF01253: Translation initiation factor SUI1 Length = 198 Score = 35.1 bits (77), Expect = 0.042 Identities = 23/71 (32%), Positives = 37/71 (52%), Gaps = 1/71 (1%) Frame = +2 Query: 266 RNGRKTLTTVQGLSS-EYDLKKIVRACKKEFACNGTVVEHPEYGEVLQLQGDQRENICQW 442 RN RK +T V+GL L + K+FA +VV+ P E + +QGD +I ++ Sbjct: 114 RNKRKCITIVKGLELFGIKLSDASKKLGKKFATGASVVKGPTEKEQIDVQGDIIYDIVEF 173 Query: 443 LTKSGLVKPEQ 475 +T + PE+ Sbjct: 174 ITDTWPDVPER 184 >At1g05530.1 68414.m00567 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 455 Score = 33.9 bits (74), Expect = 0.096 Identities = 23/57 (40%), Positives = 34/57 (59%), Gaps = 3/57 (5%) Frame = +2 Query: 128 VSLKQRDPTFNRMSIQNLN--TF-DPFADAIKSSEDDVQDGLVHVRIQQRNGRKTLT 289 +S+ R N +++NL+ TF D F D + S+ DDVQ+ LVH +RNG K L+ Sbjct: 41 LSVIHRSMIPNHNNVENLSFLTFSDGFDDGVISNTDDVQNRLVHF---ERNGDKALS 94 >At5g49130.1 68418.m06081 MATE efflux family protein contains Pfam profile PF01554: MatE Uncharacterized membrane protein family Length = 502 Score = 30.3 bits (65), Expect = 1.2 Identities = 19/39 (48%), Positives = 23/39 (58%), Gaps = 4/39 (10%) Frame = -3 Query: 381 CSTTVP-LHANSFLHARTIFFRSYSEERP---CTVVSVL 277 CS ++P L ANSFLH I+ R P CT+VSVL Sbjct: 150 CSFSLPDLLANSFLHPLRIYLRCKGTTWPLMWCTLVSVL 188 >At2g15345.1 68415.m01755 expressed protein Length = 121 Score = 29.9 bits (64), Expect = 1.6 Identities = 20/52 (38%), Positives = 29/52 (55%), Gaps = 5/52 (9%) Frame = +2 Query: 239 GLVHVRIQQ--RNGRKTLTTVQGL--SSEYD-LKKIVRACKKEFACNGTVVE 379 GLV++ QQ R G K L ++GL + Y LKK R+C KE+ + +E Sbjct: 3 GLVNMVYQQTERLGYKNLEMIKGLDRTENYSKLKKYYRSCVKEYELSNKAIE 54 >At1g63430.1 68414.m07173 leucine-rich repeat transmembrane protein kinase, putative contains Pfam profiles: PF00069 Eukaryotic protein kinase domain, PF00560 Leucine Rich Repeat; contains 1 predicted transmembrane domain Length = 664 Score = 27.9 bits (59), Expect = 6.3 Identities = 13/39 (33%), Positives = 19/39 (48%) Frame = +2 Query: 317 DLKKIVRACKKEFACNGTVVEHPEYGEVLQLQGDQRENI 433 ++ R E+A NGT+ EH YGE + +R I Sbjct: 429 EISPFTRMLVFEYASNGTLYEHLHYGEAALVSWARRMKI 467 >At5g04780.1 68418.m00494 SEC14 cytosolic factor-related contains Pfam PF00650 : CRAL/TRIO domain; contains Pfam PF03765 : CRAL/TRIO, N-terminus; contains Pfam profile PF01535: PPR repeat (three copies) Length = 864 Score = 27.5 bits (58), Expect = 8.4 Identities = 17/58 (29%), Positives = 33/58 (56%), Gaps = 2/58 (3%) Frame = -2 Query: 334 HDLLQVIFRGKALHRSQRLT-PVSLLDTDVD*TILNVVLRAFDSIGEWVECV-EILDG 167 H++LQ+ R A+ ++ + +D + D T+LNV++ A+ G +VE ++ DG Sbjct: 57 HEILQLCARNGAVMEAKACHGKIIRIDLEGDVTLLNVLINAYSKCG-FVELARQVFDG 113 >At1g75990.1 68414.m08824 26S proteasome regulatory subunit S3, putative (RPN3) similar to 26S proteasome regulatory subunit S3 SP:P93768 [Nicotiana tabacum (Common tobacco)] Length = 487 Score = 27.5 bits (58), Expect = 8.4 Identities = 19/75 (25%), Positives = 38/75 (50%), Gaps = 6/75 (8%) Frame = +2 Query: 68 RAHNSALSVTVILLSA*YRSVSLKQRDPTFNRMSIQN------LNTFDPFADAIKSSEDD 229 R HN + + ++ R++S+ +++R+S+Q+ LN+ +P ADA Sbjct: 342 RTHNLIVRLRHNVIRTGLRNISI-----SYSRISLQDVAQKLRLNSANPVADAESIVAKA 396 Query: 230 VQDGLVHVRIQQRNG 274 ++DG + I +NG Sbjct: 397 IRDGAIDATIDHKNG 411 >At1g27900.1 68414.m03419 RNA helicase, putative similar to SP|Q14562 ATP-dependent helicase DDX8 (RNA helicase HRH1) (DEAH-box protein 8) {Homo sapiens}; contains Pfam profiles PF04408: Helicase associated domain (HA2), PF00271: Helicase conserved C-terminal domain Length = 700 Score = 27.5 bits (58), Expect = 8.4 Identities = 16/60 (26%), Positives = 29/60 (48%) Frame = +1 Query: 91 SDSYIVECVVSQRFVETKRPYVQSYVHPESQHIRPIRRCYQKLGGRRSRWFSPRPYPATK 270 +D + VV + T RP++++ + + PI+R +KL R+ S P P+ K Sbjct: 604 NDGMMPNYVVYHELISTTRPFMRNVCAVDMAWVAPIKRKIEKLNVRK---LSGGPAPSFK 660 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,258,550 Number of Sequences: 28952 Number of extensions: 287633 Number of successful extensions: 808 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 793 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 808 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1383534864 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -