BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10n05 (731 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calc... 24 5.6 AY341187-1|AAR13751.1| 189|Anopheles gambiae GNBP A1 protein. 24 5.6 X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein. 23 7.4 AY341186-1|AAR13750.1| 189|Anopheles gambiae GNBP A1 protein. 23 7.4 AY341185-1|AAR13749.1| 189|Anopheles gambiae GNBP A1 protein. 23 7.4 AY341184-1|AAR13748.1| 187|Anopheles gambiae GNBP A1 protein. 23 7.4 AY341183-1|AAR13747.1| 189|Anopheles gambiae GNBP A1 protein. 23 7.4 AJ439353-11|CAD27933.1| 615|Anopheles gambiae 30E5.11 protein. 23 9.7 >EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calcium channel alpha1 subunit protein. Length = 1893 Score = 23.8 bits (49), Expect = 5.6 Identities = 28/110 (25%), Positives = 53/110 (48%) Frame = +1 Query: 373 VMSAYQYFTSQVMTNGVMKKLQNDGYLCTQLRLY*SVSFQCSLIQMMRVPLMLMLQKNGE 552 +++ + YF + V T ++ KL + G+L + +F + ++ V L+ M +G Sbjct: 888 ILNYFDYFFTSVFTIELLLKLVSYGFLFHD-GAFCRSAFNLLDLLVVCVSLISMFFSSGA 946 Query: 553 NDIRNSKRKLPDVLGKVKKIASRSKRIFRKEYIYC*KRAIVTPANILLQT 702 + R L VL ++ I +R+K + K + C A+ T NI+L T Sbjct: 947 ISVIKILRVL-RVLRPLRAI-NRAKGL--KHVVQCVIVAVKTIGNIVLVT 992 >AY341187-1|AAR13751.1| 189|Anopheles gambiae GNBP A1 protein. Length = 189 Score = 23.8 bits (49), Expect = 5.6 Identities = 10/28 (35%), Positives = 18/28 (64%), Gaps = 3/28 (10%) Frame = -1 Query: 182 FYWVFVQF*NKKRF---KRHSFYKRQCT 108 +YWV+VQF N+ + K+H+ + + T Sbjct: 93 YYWVYVQFANEGYWLTDKKHTITRTKAT 120 >X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein. Length = 1231 Score = 23.4 bits (48), Expect = 7.4 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = +2 Query: 629 GYLEKNIYIAEKGPL*HRQTF 691 GY + N Y+A +GPL ++TF Sbjct: 737 GYRKHNAYVATQGPL--QETF 755 >AY341186-1|AAR13750.1| 189|Anopheles gambiae GNBP A1 protein. Length = 189 Score = 23.4 bits (48), Expect = 7.4 Identities = 10/28 (35%), Positives = 18/28 (64%), Gaps = 3/28 (10%) Frame = -1 Query: 182 FYWVFVQF*NKKRF---KRHSFYKRQCT 108 +YWV+VQF N+ + K+H+ + + T Sbjct: 93 YYWVYVQFANEGYWLTDKKHTVTRTKAT 120 >AY341185-1|AAR13749.1| 189|Anopheles gambiae GNBP A1 protein. Length = 189 Score = 23.4 bits (48), Expect = 7.4 Identities = 10/28 (35%), Positives = 18/28 (64%), Gaps = 3/28 (10%) Frame = -1 Query: 182 FYWVFVQF*NKKRF---KRHSFYKRQCT 108 +YWV+VQF N+ + K+H+ + + T Sbjct: 93 YYWVYVQFANEGYWLTDKKHTVTRTKAT 120 >AY341184-1|AAR13748.1| 187|Anopheles gambiae GNBP A1 protein. Length = 187 Score = 23.4 bits (48), Expect = 7.4 Identities = 10/28 (35%), Positives = 18/28 (64%), Gaps = 3/28 (10%) Frame = -1 Query: 182 FYWVFVQF*NKKRF---KRHSFYKRQCT 108 +YWV+VQF N+ + K+H+ + + T Sbjct: 93 YYWVYVQFANEGYWLTDKKHTVTRTKAT 120 >AY341183-1|AAR13747.1| 189|Anopheles gambiae GNBP A1 protein. Length = 189 Score = 23.4 bits (48), Expect = 7.4 Identities = 10/28 (35%), Positives = 18/28 (64%), Gaps = 3/28 (10%) Frame = -1 Query: 182 FYWVFVQF*NKKRF---KRHSFYKRQCT 108 +YWV+VQF N+ + K+H+ + + T Sbjct: 93 YYWVYVQFANEGYWLTDKKHTVTRTKAT 120 >AJ439353-11|CAD27933.1| 615|Anopheles gambiae 30E5.11 protein. Length = 615 Score = 23.0 bits (47), Expect = 9.7 Identities = 11/32 (34%), Positives = 15/32 (46%) Frame = +3 Query: 3 LCQSQTVDRVYLRFGFGKGSHYWRTMRLNVHN 98 LCQ + R YLR G K + W N+ + Sbjct: 101 LCQQEREFREYLRNGSKKMTSTWENTVQNIRD 132 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 807,150 Number of Sequences: 2352 Number of extensions: 16923 Number of successful extensions: 65 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 65 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 65 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 74844540 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -