BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10n02 (675 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 25 0.66 DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channe... 22 4.7 AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 22 6.1 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 21 8.1 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 21 8.1 AB183889-1|BAD86829.1| 316|Apis mellifera Mos protein. 21 8.1 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 25.0 bits (52), Expect = 0.66 Identities = 11/35 (31%), Positives = 18/35 (51%) Frame = +2 Query: 362 VERSRERRPPPLVPSVTVVHGPRPSLPSALPPQPV 466 V + +++R + ++H LP ALPPQ V Sbjct: 1085 VSQQKQKRRMVKYGKLVMIHEENAPLPPALPPQVV 1119 >DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channel protein. Length = 463 Score = 22.2 bits (45), Expect = 4.7 Identities = 7/17 (41%), Positives = 12/17 (70%), Gaps = 1/17 (5%) Frame = -1 Query: 156 PCIILTGLSW-HWWITK 109 PC++L LSW +W+ + Sbjct: 223 PCVLLVVLSWVSFWLNR 239 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 21.8 bits (44), Expect = 6.1 Identities = 12/38 (31%), Positives = 18/38 (47%) Frame = +2 Query: 350 HLAIVERSRERRPPPLVPSVTVVHGPRPSLPSALPPQP 463 HL + ++ PP S T P+ +L +AL QP Sbjct: 343 HLHVAKQMASPEPPKSSESSTGSSIPKLNLSTALMSQP 380 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 21.4 bits (43), Expect = 8.1 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = -3 Query: 364 HYREVFGRPDEPRGGRHA 311 HYR G DE + RHA Sbjct: 1440 HYRTAHGNLDELQLSRHA 1457 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 21.4 bits (43), Expect = 8.1 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = -3 Query: 364 HYREVFGRPDEPRGGRHA 311 HYR G DE + RHA Sbjct: 1436 HYRTAHGNLDELQLSRHA 1453 >AB183889-1|BAD86829.1| 316|Apis mellifera Mos protein. Length = 316 Score = 21.4 bits (43), Expect = 8.1 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = -2 Query: 185 NRFCRANPTILASF*RVYL 129 N+F R +P IL + R+YL Sbjct: 9 NKFYRISPQILKNDKRIYL 27 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 134,980 Number of Sequences: 438 Number of extensions: 2427 Number of successful extensions: 8 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20464920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -