BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10m22 (647 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY531877-1|AAT08872.1| 247|Tribolium castaneum ORF1p protein. 27 0.10 AM292355-1|CAL23167.1| 324|Tribolium castaneum gustatory recept... 22 5.0 AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 22 5.0 AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicas... 21 6.6 AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthol... 21 8.7 >AY531877-1|AAT08872.1| 247|Tribolium castaneum ORF1p protein. Length = 247 Score = 27.5 bits (58), Expect = 0.10 Identities = 14/42 (33%), Positives = 21/42 (50%) Frame = +3 Query: 399 IERGIAKVYEDLIDSPGIDSEEINSCLNGYPVFKKDETVNDP 524 I +A+V+E + G+D+EEI L YP + V P Sbjct: 16 IHEEVAQVWEQTLQK-GLDTEEIKDLLQKYPPIANCKLVQAP 56 >AM292355-1|CAL23167.1| 324|Tribolium castaneum gustatory receptor candidate 34 protein. Length = 324 Score = 21.8 bits (44), Expect = 5.0 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = -1 Query: 389 YFLVIIL*ANYLVTRV 342 +F VIIL +NY TR+ Sbjct: 105 FFWVIILMSNYAFTRI 120 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 21.8 bits (44), Expect = 5.0 Identities = 6/21 (28%), Positives = 15/21 (71%) Frame = -1 Query: 218 IFFFH*LHHEFSCSWVYFVIN 156 I++F+ +H F C+++ F ++ Sbjct: 258 IYYFYYMHLLFCCAFIIFTMH 278 >AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicase protein. Length = 580 Score = 21.4 bits (43), Expect = 6.6 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = -1 Query: 428 FVNLSNTSLDQLHYFLV 378 FVN N S + L YF++ Sbjct: 299 FVNRGNVSFNSLKYFVL 315 >AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthologue protein. Length = 431 Score = 21.0 bits (42), Expect = 8.7 Identities = 8/37 (21%), Positives = 21/37 (56%) Frame = -3 Query: 342 VSLHKRLCHHEGILAHQLKNPSSQHCWTLIRRNDHES 232 +++H++ HH+ ++H+ + C L +DH++ Sbjct: 311 LNMHQQ--HHQQNMSHEELSAMVNRCHPLSLSSDHQA 345 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 142,630 Number of Sequences: 336 Number of extensions: 2956 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16656800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -