BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10m21 (657 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC14C4.15c ||SPAPJ760.01c|dipeptidyl aminopeptidase |Schizosac... 28 1.4 SPCC285.11 |ucp10||UBA/UAS domain protein Ucp10|Schizosaccharomy... 25 7.3 >SPAC14C4.15c ||SPAPJ760.01c|dipeptidyl aminopeptidase |Schizosaccharomyces pombe|chr 1|||Manual Length = 853 Score = 27.9 bits (59), Expect = 1.4 Identities = 19/52 (36%), Positives = 26/52 (50%) Frame = +2 Query: 104 KNGTYICSAVILNTYWLATLSDCFDRAIISSYVTHKNLGNFAIRAGSSYNNK 259 K YI AV L ++LA++ C AII + H N NF++ SY K Sbjct: 62 KKHRYIYLAVCL--FFLASVLSC---AIIFRFYLHTNRENFSLFKNDSYKQK 108 >SPCC285.11 |ucp10||UBA/UAS domain protein Ucp10|Schizosaccharomyces pombe|chr 3|||Manual Length = 427 Score = 25.4 bits (53), Expect = 7.3 Identities = 16/41 (39%), Positives = 21/41 (51%) Frame = -2 Query: 440 VQ*VSKQSSMRGSQALLPDPDWADEPRPLAIQTPKGYQA*R 318 VQ KQ + L P+P DEP L+I+ P G +A R Sbjct: 302 VQKKKKQYRAWLASNLPPEPSSEDEPARLSIRFPDGSRAVR 342 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,773,620 Number of Sequences: 5004 Number of extensions: 56345 Number of successful extensions: 167 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 162 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 167 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 297805304 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -