BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10m21 (657 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_0680 - 27217563-27220088 28 5.7 04_03_0686 + 18701543-18701917,18702658-18702702,18703175-187032... 28 7.5 >04_04_0680 - 27217563-27220088 Length = 841 Score = 28.3 bits (60), Expect = 5.7 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = +2 Query: 521 CVGGVQDPNRHFCRQDNGGAVIQND 595 CVGG D R C NGG + ND Sbjct: 611 CVGGCSDSKRCACAVKNGGEIPFND 635 >04_03_0686 + 18701543-18701917,18702658-18702702,18703175-18703289, 18703644-18703713,18703796-18703844,18704319-18704416, 18704984-18705122,18705261-18705410 Length = 346 Score = 27.9 bits (59), Expect = 7.5 Identities = 21/83 (25%), Positives = 34/83 (40%), Gaps = 3/83 (3%) Frame = +2 Query: 347 GSQVDAARLPSPDQEVMLGYLASMTAWTPTGHIRLVNAP---VIDASICEEDARLLPGHY 517 G D+++LP D + L + T +I +V A ++DA E AR Sbjct: 254 GLMKDSSKLPLFDLRKLNASLPVASVPNNTVNILVVGASSDFIVDAEGLSETARFYNVQP 313 Query: 518 ICVGGVQDPNRHFCRQDNGGAVI 586 +C+ G+ C D G +I Sbjct: 314 VCIEGIAHDMMLDCSWDKGAGII 336 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,443,222 Number of Sequences: 37544 Number of extensions: 388305 Number of successful extensions: 891 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 870 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 891 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1644004708 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -