BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10m19 (521 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A1SF09 Cluster: Binding-protein-dependent transport sys... 33 5.2 UniRef50_Q0CA66 Cluster: Predicted protein; n=1; Aspergillus ter... 32 6.9 >UniRef50_A1SF09 Cluster: Binding-protein-dependent transport systems inner membrane component precursor; n=1; Nocardioides sp. JS614|Rep: Binding-protein-dependent transport systems inner membrane component precursor - Nocardioides sp. (strain BAA-499 / JS614) Length = 284 Score = 32.7 bits (71), Expect = 5.2 Identities = 16/34 (47%), Positives = 21/34 (61%) Frame = -2 Query: 445 GYAYAINALRFERTDLSAKLFIYILPELGKLLAL 344 GYA+A RF RT L A L IY+LP + ++ L Sbjct: 100 GYAFARLRFRFRRTSLFAFLAIYMLPPIALVIPL 133 >UniRef50_Q0CA66 Cluster: Predicted protein; n=1; Aspergillus terreus NIH2624|Rep: Predicted protein - Aspergillus terreus (strain NIH 2624) Length = 406 Score = 32.3 bits (70), Expect = 6.9 Identities = 21/60 (35%), Positives = 32/60 (53%), Gaps = 3/60 (5%) Frame = -2 Query: 433 AINALRFERTDLSAKLFIYILPELGKL--LALCQSALKQLVNCNV-KYKVPI*FRTFKIS 263 AI A +FER ++++ PE L LA CQ+AL+ + C++ K P+ FR S Sbjct: 161 AIGA-QFERAQQRERVYVIDEPEAATLSVLAQCQNALEDITTCSILSVKPPLAFRQITAS 219 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 397,259,447 Number of Sequences: 1657284 Number of extensions: 6708907 Number of successful extensions: 14046 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 13731 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14044 length of database: 575,637,011 effective HSP length: 95 effective length of database: 418,195,031 effective search space used: 32619212418 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -