BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10m18 (258 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g27510.1 68418.m03291 protein kinase family protein contains ... 26 3.0 At3g16690.1 68416.m02132 nodulin MtN3 family protein contains Pf... 25 9.1 At2g03520.1 68415.m00312 expressed protein similar to SP|Q41706 ... 25 9.1 >At5g27510.1 68418.m03291 protein kinase family protein contains protein kinase domain, Pfam:PF00069; contains serine/threonine protein kinase domain, INTERPRO:IPR002290 Length = 301 Score = 26.2 bits (55), Expect = 3.0 Identities = 13/30 (43%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Frame = +3 Query: 3 SILIYGNIYCLLGPNVVRIYVCG-SLEIKI 89 SI +G ++C L P V ++ CG S E+KI Sbjct: 123 SIHSHGYVHCDLKPENVLVFPCGDSYEVKI 152 >At3g16690.1 68416.m02132 nodulin MtN3 family protein contains Pfam PF03083 MtN3/saliva family Length = 230 Score = 24.6 bits (51), Expect = 9.1 Identities = 11/22 (50%), Positives = 15/22 (68%), Gaps = 1/22 (4%) Frame = -3 Query: 256 FFL-IMQVLFYCYYNIAKTFIQ 194 FFL IMQ+L Y YY A+ ++ Sbjct: 196 FFLGIMQLLIYAYYRNAEPIVE 217 >At2g03520.1 68415.m00312 expressed protein similar to SP|Q41706 A3 protein (unknown function) {Vigna unguiculata} Length = 388 Score = 24.6 bits (51), Expect = 9.1 Identities = 9/28 (32%), Positives = 21/28 (75%), Gaps = 1/28 (3%) Frame = +2 Query: 164 IINIIINVTFLYKCLCNIV-VTIKKYLH 244 +I++I+N+ FLY+ + + ++KKY++ Sbjct: 273 LISLILNLIFLYRPMVGLARSSLKKYIY 300 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 4,194,263 Number of Sequences: 28952 Number of extensions: 57598 Number of successful extensions: 80 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 77 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 80 length of database: 12,070,560 effective HSP length: 64 effective length of database: 10,217,632 effective search space used: 214570272 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -