BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10m17 (738 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value U81038-1|AAB39355.1| 412|Tribolium castaneum transcription fact... 22 4.5 AF321227-3|AAK16423.1| 412|Tribolium castaneum Dfd protein. 22 4.5 AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B prot... 21 7.9 >U81038-1|AAB39355.1| 412|Tribolium castaneum transcription factor Deformed protein. Length = 412 Score = 22.2 bits (45), Expect = 4.5 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +1 Query: 628 LGQDKLIDYCKRNGIVVMAFSPFGPMFHDSLP 723 LG++ + R+ I M S PM HD LP Sbjct: 342 LGENMMDMSLTRHQISSMGHSHAHPMHHDMLP 373 >AF321227-3|AAK16423.1| 412|Tribolium castaneum Dfd protein. Length = 412 Score = 22.2 bits (45), Expect = 4.5 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +1 Query: 628 LGQDKLIDYCKRNGIVVMAFSPFGPMFHDSLP 723 LG++ + R+ I M S PM HD LP Sbjct: 342 LGENMMDMSLTRHQISSMGHSHAHPMHHDMLP 373 >AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B protein. Length = 351 Score = 21.4 bits (43), Expect = 7.9 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = -2 Query: 293 ARTAAPI*SSFKYNAAVSINLYPASKAHLTGFSES 189 A TAA + +KY+AA P+ + GFS S Sbjct: 111 AATAAATATEYKYSAAAPGPSDPSVSSCHQGFSSS 145 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 176,784 Number of Sequences: 336 Number of extensions: 3807 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19779950 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -