BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10m16 (638 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF444780-1|AAL37901.1| 1152|Anopheles gambiae Toll protein. 25 2.7 AY263176-1|AAP78791.1| 705|Anopheles gambiae TmcB-like protein ... 23 6.2 >AF444780-1|AAL37901.1| 1152|Anopheles gambiae Toll protein. Length = 1152 Score = 24.6 bits (51), Expect = 2.7 Identities = 15/67 (22%), Positives = 24/67 (35%) Frame = +3 Query: 363 IRAGLAVTMVVTKADIKAVIREASADFQGTRAMEGTDRDIRAAVPVTRATNLDTTNTDPV 542 +R V K+ + QG ++ I+ V L T T+P+ Sbjct: 1037 VRGASGTASTVVKSGVSTAGGLFMKQLQGAAPVDDRLELIKPQVTPATPPALTTPPTEPI 1096 Query: 543 STGTPRP 563 S+ TP P Sbjct: 1097 SSATPAP 1103 >AY263176-1|AAP78791.1| 705|Anopheles gambiae TmcB-like protein protein. Length = 705 Score = 23.4 bits (48), Expect = 6.2 Identities = 9/32 (28%), Positives = 17/32 (53%) Frame = -1 Query: 116 SSRPPSSITKEDSNNSLYKYLITEFTIDNFVL 21 ++RPP+ + LY+ L+ +F I +L Sbjct: 392 TTRPPTGCWETAIGQELYRLLVVDFFISTVLL 423 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 410,764 Number of Sequences: 2352 Number of extensions: 6472 Number of successful extensions: 11 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 62723250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -