BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10m11 (678 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cycl... 24 1.5 DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channe... 22 6.2 AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methylt... 21 8.2 >AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cyclase alpha 1 subunit protein. Length = 699 Score = 23.8 bits (49), Expect = 1.5 Identities = 11/31 (35%), Positives = 19/31 (61%) Frame = +3 Query: 309 ITSLIIGETEEDAENDQIYTFKISHSNQSIV 401 +TSL++ E EDAE+ Q T + H +++ Sbjct: 46 VTSLLMREETEDAEDTQ--TLNLKHLRAAVL 74 >DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channel protein. Length = 463 Score = 21.8 bits (44), Expect = 6.2 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -1 Query: 576 YVLHPTVSHYRRNLLKQYFHL 514 Y T+SH ++L YFHL Sbjct: 189 YSASTTLSHAEYSMLLVYFHL 209 >AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methyltransferase protein. Length = 683 Score = 21.4 bits (43), Expect = 8.2 Identities = 7/18 (38%), Positives = 9/18 (50%) Frame = +2 Query: 413 KWPN*NVGQRNWSPTKNL 466 KW N ++ W P NL Sbjct: 264 KWKNWDLKYNTWEPISNL 281 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 168,219 Number of Sequences: 438 Number of extensions: 3369 Number of successful extensions: 9 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20586735 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -