Bombyx BLAST Result against spombe

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= bmte10m08
         (697 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBC1347.10 |cdc23|mcm10|MCM-associated protein Mcm10|Schizosacc...    28   1.5  
SPBC17D11.01 |nep1||nedd8 protease Nep1|Schizosaccharomyces pomb...    24   2.1  
SPBC1289.16c ||SPBC8E4.06|copper amine oxidase |Schizosaccharomy...    24   3.4  

>SPBC1347.10 |cdc23|mcm10|MCM-associated protein
           Mcm10|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 593

 Score = 27.9 bits (59), Expect = 1.5
 Identities = 13/37 (35%), Positives = 19/37 (51%)
 Frame = +3

Query: 396 DSHVGDFCERENDAGNRKSLSSPSHF*NSMCTTSSVR 506
           D   GD CE   D   ++S+S+ + F +SM T    R
Sbjct: 314 DKRAGDVCEYHVDLAVQRSMSTRTEFASSMATMHEPR 350


>SPBC17D11.01 |nep1||nedd8 protease Nep1|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 420

 Score = 23.8 bits (49), Expect(2) = 2.1
 Identities = 6/8 (75%), Positives = 8/8 (100%)
 Frame = +1

Query: 445 GNHYHHHH 468
           G+H+HHHH
Sbjct: 298 GHHHHHHH 305



 Score = 21.8 bits (44), Expect(2) = 2.1
 Identities = 6/9 (66%), Positives = 8/9 (88%)
 Frame = +1

Query: 448 NHYHHHHIS 474
           +H+HHHH S
Sbjct: 303 HHHHHHHHS 311


>SPBC1289.16c ||SPBC8E4.06|copper amine oxidase |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 794

 Score = 23.8 bits (49), Expect(2) = 3.4
 Identities = 6/8 (75%), Positives = 8/8 (100%)
 Frame = +1

Query: 445 GNHYHHHH 468
           G+H+HHHH
Sbjct: 741 GHHHHHHH 748



 Score = 21.0 bits (42), Expect(2) = 3.4
 Identities = 5/9 (55%), Positives = 9/9 (100%)
 Frame = +1

Query: 448 NHYHHHHIS 474
           +H+HHH+I+
Sbjct: 744 HHHHHHYIT 752


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,743,063
Number of Sequences: 5004
Number of extensions: 53482
Number of successful extensions: 102
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 92
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 100
length of database: 2,362,478
effective HSP length: 71
effective length of database: 2,007,194
effective search space used: 321151040
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)