BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10m08 (697 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ201783-1|ABB05503.1| 381|Apis mellifera capa receptor-like GP... 23 2.8 AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 23 3.7 AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 22 6.4 >DQ201783-1|ABB05503.1| 381|Apis mellifera capa receptor-like GPCR protein. Length = 381 Score = 23.0 bits (47), Expect = 2.8 Identities = 10/35 (28%), Positives = 18/35 (51%) Frame = +2 Query: 437 WKSEIIIITITFLKFYVYHLLRASYFSVLRVVTFT 541 W+ ++ ++ K Y +SY SVL +V F+ Sbjct: 102 WQQYPWVLGVSLCKIRAYVSEMSSYVSVLTIVAFS 136 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.6 bits (46), Expect = 3.7 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = -2 Query: 612 HQRRYPLRGEDRSEWRNIVLIKCS 541 H R LR EDR+ +RN CS Sbjct: 231 HSRYEDLRHEDRNSYRNDGERSCS 254 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 21.8 bits (44), Expect = 6.4 Identities = 6/11 (54%), Positives = 9/11 (81%) Frame = +1 Query: 451 HYHHHHISEIL 483 H+HHHH ++ L Sbjct: 351 HHHHHHQTQSL 361 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 180,584 Number of Sequences: 438 Number of extensions: 3736 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21317625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -