BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10m05 (713 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. 25 0.61 AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. 24 1.1 AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface pro... 21 9.9 >DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. Length = 822 Score = 25.0 bits (52), Expect = 0.61 Identities = 11/48 (22%), Positives = 27/48 (56%) Frame = +1 Query: 340 LPKCMYHIKNPIDLTEEDEICLKINEKGPNNKMTELETRQDELLNKLE 483 LP+ +++ +D+ E+D I + N + +K+ L Q+ L ++++ Sbjct: 314 LPEIQHNLDVLVDMCEQDIIRIDRNTRFNQDKIVALRQEQETLKSQVQ 361 >AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. Length = 712 Score = 24.2 bits (50), Expect = 1.1 Identities = 11/38 (28%), Positives = 22/38 (57%), Gaps = 3/38 (7%) Frame = -1 Query: 371 GFLMWYIHFGNSILSSWSTILFITYIIIYQP---YPRC 267 G+ +++ HF I+ + I+ + +IY+P +PRC Sbjct: 665 GYWLFHCHFLFHIVIGMNLIIHVGTQLIYRPFSHFPRC 702 >AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface protein chaoptin protein. Length = 782 Score = 21.0 bits (42), Expect = 9.9 Identities = 10/29 (34%), Positives = 19/29 (65%) Frame = +1 Query: 544 NIQSSNASKVESVITPEEVVLVLSPDSLP 630 N+ + + S+V ++ TP + L L+ +SLP Sbjct: 451 NLDNVSLSQVPALSTPNLLSLSLAFNSLP 479 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 164,039 Number of Sequences: 336 Number of extensions: 3711 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18947110 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -