BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10m04 (591 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g24550.1 68416.m03083 protein kinase family protein contains ... 33 0.14 At1g26400.1 68414.m03220 FAD-binding domain-containing protein s... 31 0.76 At5g65630.1 68418.m08256 DNA-binding bromodomain-containing prot... 29 1.8 At4g13390.1 68417.m02092 proline-rich extensin-like family prote... 29 1.8 At4g15160.1 68417.m02327 protease inhibitor/seed storage/lipid t... 29 3.1 At5g06940.1 68418.m00784 leucine-rich repeat family protein cont... 28 4.1 At4g33430.1 68417.m04750 brassinosteroid insensitive 1-associate... 28 4.1 At1g78700.1 68414.m09173 brassinosteroid signalling positive reg... 28 4.1 At5g65390.1 68418.m08224 arabinogalactan-protein (AGP7) 28 5.4 At3g56140.1 68416.m06240 expressed protein At2g40400 - Arabidops... 27 7.1 At3g22120.1 68416.m02792 protease inhibitor/seed storage/lipid t... 27 7.1 At1g56530.1 68414.m06501 hydroxyproline-rich glycoprotein family... 27 7.1 At1g19270.1 68414.m02397 ubiquitin interaction motif-containing ... 27 7.1 At5g52750.1 68418.m06547 heavy-metal-associated domain-containin... 27 9.4 At4g16790.1 68417.m02536 hydroxyproline-rich glycoprotein family... 27 9.4 At1g23720.1 68414.m02994 proline-rich extensin-like family prote... 27 9.4 At1g02405.1 68414.m00187 proline-rich family protein contains pr... 27 9.4 At1g02110.1 68414.m00137 proline-rich family protein contains pr... 27 9.4 >At3g24550.1 68416.m03083 protein kinase family protein contains Pfam domain PF00069: Protein kinase domain Length = 652 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/39 (35%), Positives = 18/39 (46%) Frame = +1 Query: 403 SPEKTLTTIVRPPGACDPPKMQCPNTPAPAPDKDCPLRP 519 SP TT PP A PP P++P P+P + P Sbjct: 17 SPPTNSTTTTPPPAASSPPPTTTPSSPPPSPSTNSTSPP 55 >At1g26400.1 68414.m03220 FAD-binding domain-containing protein similar to SP|P30986 reticuline oxidase precursor (Berberine-bridge-forming enzyme) (BBE) (Tetrahydroprotoberberine synthase) [Eschscholzia californica]; contains PF01565 FAD binding domain Length = 527 Score = 30.7 bits (66), Expect = 0.76 Identities = 18/46 (39%), Positives = 23/46 (50%), Gaps = 1/46 (2%) Frame = -2 Query: 392 YEYATPNVPDNNKATSFVCSDFDLCVNPFRTSILSWIILS-KYFLG 258 YE A P V N + F DFD+ +NP ++ I KYFLG Sbjct: 452 YEVAGPYVSSNPREALFNFRDFDIGINPSGLNVDEAKIYGYKYFLG 497 >At5g65630.1 68418.m08256 DNA-binding bromodomain-containing protein similar to 5.9 kb fsh membrane protein [Drosophila melanogaster] GI:157455; contains Pfam profile PF00439: Bromodomain Length = 590 Score = 29.5 bits (63), Expect = 1.8 Identities = 17/61 (27%), Positives = 30/61 (49%) Frame = +1 Query: 313 FTQRSKSEQTKLVALLLSGTLGVAYSYGMFSPEKTLTTIVRPPGACDPPKMQCPNTPAPA 492 F QR ++ +VA GT ++ + + S + T+ PP +P ++Q P+ P P Sbjct: 296 FKQRQWNQNPPMVANPRKGTEQISIAKKLDSVKPPQPTL--PPQLVEPSRVQSPSPPPPP 353 Query: 493 P 495 P Sbjct: 354 P 354 >At4g13390.1 68417.m02092 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 429 Score = 29.5 bits (63), Expect = 1.8 Identities = 15/43 (34%), Positives = 23/43 (53%), Gaps = 1/43 (2%) Frame = +1 Query: 136 P*IHSSYPK*TYIEPMTP-NLK*PPPNTMYNGIKPTRLWHLTP 261 P ++SS P TY P + K PPP +YN + P +++ P Sbjct: 308 PYVYSSPPPPTYYSPSPRVDYKSPPPPYVYNSLPPPYVYNSPP 350 >At4g15160.1 68417.m02327 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to SP|Q00451|PRF1_LYCES 36.4 kDa proline-rich protein Lycopersicon esculentum, proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 428 Score = 28.7 bits (61), Expect = 3.1 Identities = 18/55 (32%), Positives = 22/55 (40%), Gaps = 1/55 (1%) Frame = +1 Query: 334 EQTKLVALLLSGTLGVAYSYGMFSPEKTLTTIVRPP-GACDPPKMQCPNTPAPAP 495 + V LLL G L V+Y+ P K V+PP PPK P P Sbjct: 7 QNISFVILLLLGLLAVSYACDCSDPPKPSPHPVKPPKHPAKPPKPPTVKPPTHTP 61 Score = 27.1 bits (57), Expect = 9.4 Identities = 12/30 (40%), Positives = 15/30 (50%) Frame = +1 Query: 430 VRPPGACDPPKMQCPNTPAPAPDKDCPLRP 519 V+PP PP + P P P P+ CP P Sbjct: 143 VKPP----PPPVVTPPPPTPTPEAPCPPPP 168 >At5g06940.1 68418.m00784 leucine-rich repeat family protein contains protein kinase domain, Pfam:PF00069; contains leucine-rich repeats, Pfam:PF00560 Length = 872 Score = 28.3 bits (60), Expect = 4.1 Identities = 27/95 (28%), Positives = 39/95 (41%), Gaps = 6/95 (6%) Frame = +1 Query: 211 NTMYNGIKPTRLWHLTPRKYFDRMIQDKI--EVRNGFTQRSKSEQTKLVALLLSGT---- 372 N ++G P LW L PR R ++ +V + S EQ ++V SG Sbjct: 326 NNGFSGEFPVVLWKL-PRIKIIRADNNRFTGQVPESVSLASALEQVEIVNNSFSGEIPHG 384 Query: 373 LGVAYSYGMFSPEKTLTTIVRPPGACDPPKMQCPN 477 LG+ S FS + + PP CD P + N Sbjct: 385 LGLVKSLYKFSASQNRFSGELPPNFCDSPVLSIVN 419 >At4g33430.1 68417.m04750 brassinosteroid insensitive 1-associated receptor kinase 1 (BAK1) / somatic embryogenesis receptor-like kinase 3 (SERK3) identical to SP|Q94F62 BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 precursor (EC 2.7.1.37) (BRI1-associated receptor kinase 1) (Somatic embryogenesis receptor-like kinase 3) {Arabidopsis thaliana}; contains Pfam domains PF00560: Leucine Rich Repeat and PF00069: Protein kinase domain; identical to cDNA somatic embryogenesis receptor-like kinase 3 (SERK3) GI:14573458 Length = 615 Score = 28.3 bits (60), Expect = 4.1 Identities = 15/44 (34%), Positives = 23/44 (52%) Frame = +1 Query: 361 LSGTLGVAYSYGMFSPEKTLTTIVRPPGACDPPKMQCPNTPAPA 492 L+G + V S+ +F+P T + P A PP + P P+PA Sbjct: 176 LTGDIPVNGSFSLFTPISFANTKLTPLPASPPPPIS-PTPPSPA 218 >At1g78700.1 68414.m09173 brassinosteroid signalling positive regulator-related contains similarity to BZR1 protein [Arabidopsis thaliana] gi|20270971|gb|AAM18490 Length = 325 Score = 28.3 bits (60), Expect = 4.1 Identities = 13/44 (29%), Positives = 21/44 (47%) Frame = -2 Query: 428 IVVSVFSGLNIPYEYATPNVPDNNKATSFVCSDFDLCVNPFRTS 297 I +F+GL + Y P DNN+ +C++ V P T+ Sbjct: 26 IAAKIFTGLRMYGNYELPKHCDNNEVLKALCNEAGWIVEPDGTT 69 >At5g65390.1 68418.m08224 arabinogalactan-protein (AGP7) Length = 130 Score = 27.9 bits (59), Expect = 5.4 Identities = 12/35 (34%), Positives = 14/35 (40%) Frame = +1 Query: 406 PEKTLTTIVRPPGACDPPKMQCPNTPAPAPDKDCP 510 P T PP A P P + AP+P D P Sbjct: 42 PAATPAPTTTPPPAVSPAPTSSPPSSAPSPSSDAP 76 >At3g56140.1 68416.m06240 expressed protein At2g40400 - Arabidopsis thaliana, EMBL:AC007020 Length = 745 Score = 27.5 bits (58), Expect = 7.1 Identities = 13/47 (27%), Positives = 22/47 (46%) Frame = +1 Query: 355 LLLSGTLGVAYSYGMFSPEKTLTTIVRPPGACDPPKMQCPNTPAPAP 495 L+ + +L + S + S E + T+ P + PP TP+P P Sbjct: 75 LVSAASLFLKPSVSLASEESSSATVTSPAESAAPPPPPATTTPSPPP 121 >At3g22120.1 68416.m02792 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to SP|Q00451|PRF1_LYCES 36.4 kDa proline-rich protein Lycopersicon esculentum, proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 334 Score = 27.5 bits (58), Expect = 7.1 Identities = 17/65 (26%), Positives = 26/65 (40%) Frame = +1 Query: 325 SKSEQTKLVALLLSGTLGVAYSYGMFSPEKTLTTIVRPPGACDPPKMQCPNTPAPAPDKD 504 S+S+ + LLL G + V+Y+ P+ + P PPK P P K Sbjct: 3 SRSQNLSFLVLLLLGFVAVSYACDCTPPKPSPAPHKPPKHPVKPPKPPAVKPPKPPAVKP 62 Query: 505 CPLRP 519 +P Sbjct: 63 PTPKP 67 >At1g56530.1 68414.m06501 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; Length = 185 Score = 27.5 bits (58), Expect = 7.1 Identities = 10/28 (35%), Positives = 14/28 (50%) Frame = +1 Query: 436 PPGACDPPKMQCPNTPAPAPDKDCPLRP 519 PP + PP + P+ P+P P L P Sbjct: 153 PPESLPPPSPESPSPPSPEPPPPSSLEP 180 >At1g19270.1 68414.m02397 ubiquitin interaction motif-containing protein / LIM domain-containing protein weak similarity to LIM-homeobox protein [Mus musculus] GI:2149584, Hic-5 [Mus musculus] GI:664955; contains Pfam profiles PF02809: Ubiquitin interaction motif, PF00412: LIM domain Length = 532 Score = 27.5 bits (58), Expect = 7.1 Identities = 10/33 (30%), Positives = 19/33 (57%) Frame = +3 Query: 168 LYRTNDAKFKVATTKHNVQRYQTDPPMASHTEE 266 +++ ++ + +V KHN Y + P ASH +E Sbjct: 7 IFKGSNQRLRVGNNKHNHNVYYDNYPTASHDDE 39 >At5g52750.1 68418.m06547 heavy-metal-associated domain-containing protein Pfam profile PF00403: Heavy-metal-associated domain Length = 139 Score = 27.1 bits (57), Expect = 9.4 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +1 Query: 427 IVRPPGACDPPKMQCPNTPAPAPDK 501 +V+PP P+ P PAPAP K Sbjct: 71 VVKPPEKKPEPEKPAPPKPAPAPAK 95 >At4g16790.1 68417.m02536 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 473 Score = 27.1 bits (57), Expect = 9.4 Identities = 12/25 (48%), Positives = 18/25 (72%) Frame = +1 Query: 331 SEQTKLVALLLSGTLGVAYSYGMFS 405 + QT+L+ LL +G+A SYG+FS Sbjct: 53 ANQTRLLELLHLVFVGIAVSYGLFS 77 >At1g23720.1 68414.m02994 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 895 Score = 27.1 bits (57), Expect = 9.4 Identities = 16/43 (37%), Positives = 22/43 (51%), Gaps = 3/43 (6%) Frame = +1 Query: 118 KMIVKSP*---IHSSYPK*TYIEPMTPNLK*PPPNTMYNGIKP 237 K++ KSP ++SS P Y P+ K PPP +YN P Sbjct: 476 KVVYKSPPPPYVYSSPPPPYYSPSPKPSYKSPPPPYVYNSPPP 518 >At1g02405.1 68414.m00187 proline-rich family protein contains proline-rich region, INTERPRO:IPR000694 Length = 134 Score = 27.1 bits (57), Expect = 9.4 Identities = 12/35 (34%), Positives = 14/35 (40%) Frame = +1 Query: 406 PEKTLTTIVRPPGACDPPKMQCPNTPAPAPDKDCP 510 P + T PP P K CP +P P P P Sbjct: 56 PPPSCTPSPPPPSPPPPKKSSCPPSPLPPPPPPPP 90 >At1g02110.1 68414.m00137 proline-rich family protein contains proline-rich domain, INTERPRO:IPR000694 Length = 679 Score = 27.1 bits (57), Expect = 9.4 Identities = 20/85 (23%), Positives = 36/85 (42%), Gaps = 4/85 (4%) Frame = +1 Query: 277 RMIQDKIEVRNGFTQRSKSEQTKLVALLLSGTLGVAYSYGMFSPEKTLTTIVRPPGACDP 456 R+++D + R+ + S+ + + L S A + E T +RP + D Sbjct: 22 RLMKDAVYARHHLAA-AHSDYCRSLRLTGSALSSFAAGEPLSVSENTPAVFLRPSSSQDA 80 Query: 457 PKMQCPNTPAPAP----DKDCPLRP 519 P++ ++P P P K P RP Sbjct: 81 PRVPSSHSPEPPPPPIRSKPKPTRP 105 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,141,957 Number of Sequences: 28952 Number of extensions: 296883 Number of successful extensions: 1033 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 878 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1026 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1171109464 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -