BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10m03 (660 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-spe... 24 3.7 DQ986315-1|ABK59975.1| 504|Anopheles gambiae catalase protein. 23 6.5 DQ980210-1|ABL09378.1| 504|Anopheles gambiae catalase protein. 23 6.5 DQ980209-1|ABL09377.1| 504|Anopheles gambiae catalase protein. 23 6.5 DQ980208-1|ABL09376.1| 504|Anopheles gambiae catalase protein. 23 6.5 DQ980207-1|ABL09375.1| 504|Anopheles gambiae catalase protein. 23 6.5 DQ980206-1|ABL09374.1| 504|Anopheles gambiae catalase protein. 23 6.5 DQ980205-1|ABL09373.1| 504|Anopheles gambiae catalase protein. 23 6.5 DQ980204-1|ABL09372.1| 504|Anopheles gambiae catalase protein. 23 6.5 DQ980203-1|ABL09371.1| 504|Anopheles gambiae catalase protein. 23 6.5 DQ980202-1|ABL09370.1| 504|Anopheles gambiae catalase protein. 23 6.5 DQ980201-1|ABL09369.1| 504|Anopheles gambiae catalase protein. 23 6.5 DQ980200-1|ABL09368.1| 504|Anopheles gambiae catalase protein. 23 6.5 DQ980199-1|ABL09367.1| 504|Anopheles gambiae catalase protein. 23 6.5 AY505416-1|AAR90327.1| 485|Anopheles gambiae catalase 1 protein. 23 6.5 U28809-1|AAC47326.1| 140|Anopheles gambiae lysozyme protein. 23 8.5 DQ007317-1|AAY24699.1| 140|Anopheles gambiae lysozyme c-1 protein. 23 8.5 DQ004402-1|AAY21241.1| 144|Anopheles gambiae lysozyme c-8 protein. 23 8.5 AY745220-1|AAU93487.1| 101|Anopheles gambiae cytochrome P450 pr... 23 8.5 >AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 234 Score = 24.2 bits (50), Expect = 3.7 Identities = 9/29 (31%), Positives = 15/29 (51%) Frame = -2 Query: 497 QKLHRHLSVPFHLHRRVQFG*CKHHSRDP 411 Q +H+ ++ P H+H V +HH P Sbjct: 151 QPVHKVIAQPVHVHAPVAHATVQHHHAAP 179 >DQ986315-1|ABK59975.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.4 bits (48), Expect = 6.5 Identities = 7/24 (29%), Positives = 14/24 (58%) Frame = -3 Query: 343 FADVHSAHPGFNFAVITRSCPHTI 272 +AD H G N+ ++ +CP+ + Sbjct: 354 YADTHRHRVGANYLMLPVNCPYRV 377 >DQ980210-1|ABL09378.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.4 bits (48), Expect = 6.5 Identities = 7/24 (29%), Positives = 14/24 (58%) Frame = -3 Query: 343 FADVHSAHPGFNFAVITRSCPHTI 272 +AD H G N+ ++ +CP+ + Sbjct: 354 YADTHRHRVGANYLMLPVNCPYRV 377 >DQ980209-1|ABL09377.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.4 bits (48), Expect = 6.5 Identities = 7/24 (29%), Positives = 14/24 (58%) Frame = -3 Query: 343 FADVHSAHPGFNFAVITRSCPHTI 272 +AD H G N+ ++ +CP+ + Sbjct: 354 YADTHRHRVGANYLMLPVNCPYRV 377 >DQ980208-1|ABL09376.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.4 bits (48), Expect = 6.5 Identities = 7/24 (29%), Positives = 14/24 (58%) Frame = -3 Query: 343 FADVHSAHPGFNFAVITRSCPHTI 272 +AD H G N+ ++ +CP+ + Sbjct: 354 YADTHRHRVGANYLMLPVNCPYRV 377 >DQ980207-1|ABL09375.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.4 bits (48), Expect = 6.5 Identities = 7/24 (29%), Positives = 14/24 (58%) Frame = -3 Query: 343 FADVHSAHPGFNFAVITRSCPHTI 272 +AD H G N+ ++ +CP+ + Sbjct: 354 YADTHRHRVGANYLMLPVNCPYRV 377 >DQ980206-1|ABL09374.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.4 bits (48), Expect = 6.5 Identities = 7/24 (29%), Positives = 14/24 (58%) Frame = -3 Query: 343 FADVHSAHPGFNFAVITRSCPHTI 272 +AD H G N+ ++ +CP+ + Sbjct: 354 YADTHRHRVGANYLMLPVNCPYRV 377 >DQ980205-1|ABL09373.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.4 bits (48), Expect = 6.5 Identities = 7/24 (29%), Positives = 14/24 (58%) Frame = -3 Query: 343 FADVHSAHPGFNFAVITRSCPHTI 272 +AD H G N+ ++ +CP+ + Sbjct: 354 YADTHRHRVGANYLMLPVNCPYRV 377 >DQ980204-1|ABL09372.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.4 bits (48), Expect = 6.5 Identities = 7/24 (29%), Positives = 14/24 (58%) Frame = -3 Query: 343 FADVHSAHPGFNFAVITRSCPHTI 272 +AD H G N+ ++ +CP+ + Sbjct: 354 YADTHRHRVGANYLMLPVNCPYRV 377 >DQ980203-1|ABL09371.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.4 bits (48), Expect = 6.5 Identities = 7/24 (29%), Positives = 14/24 (58%) Frame = -3 Query: 343 FADVHSAHPGFNFAVITRSCPHTI 272 +AD H G N+ ++ +CP+ + Sbjct: 354 YADTHRHRVGANYLMLPVNCPYRV 377 >DQ980202-1|ABL09370.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.4 bits (48), Expect = 6.5 Identities = 7/24 (29%), Positives = 14/24 (58%) Frame = -3 Query: 343 FADVHSAHPGFNFAVITRSCPHTI 272 +AD H G N+ ++ +CP+ + Sbjct: 354 YADTHRHRVGANYLMLPVNCPYRV 377 >DQ980201-1|ABL09369.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.4 bits (48), Expect = 6.5 Identities = 7/24 (29%), Positives = 14/24 (58%) Frame = -3 Query: 343 FADVHSAHPGFNFAVITRSCPHTI 272 +AD H G N+ ++ +CP+ + Sbjct: 354 YADTHRHRVGANYLMLPVNCPYRV 377 >DQ980200-1|ABL09368.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.4 bits (48), Expect = 6.5 Identities = 7/24 (29%), Positives = 14/24 (58%) Frame = -3 Query: 343 FADVHSAHPGFNFAVITRSCPHTI 272 +AD H G N+ ++ +CP+ + Sbjct: 354 YADTHRHRVGANYLMLPVNCPYRV 377 >DQ980199-1|ABL09367.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.4 bits (48), Expect = 6.5 Identities = 7/24 (29%), Positives = 14/24 (58%) Frame = -3 Query: 343 FADVHSAHPGFNFAVITRSCPHTI 272 +AD H G N+ ++ +CP+ + Sbjct: 354 YADTHRHRVGANYLMLPVNCPYRV 377 >AY505416-1|AAR90327.1| 485|Anopheles gambiae catalase 1 protein. Length = 485 Score = 23.4 bits (48), Expect = 6.5 Identities = 7/24 (29%), Positives = 14/24 (58%) Frame = -3 Query: 343 FADVHSAHPGFNFAVITRSCPHTI 272 +AD H G N+ ++ +CP+ + Sbjct: 338 YADTHRHRVGANYLMLPVNCPYRV 361 >U28809-1|AAC47326.1| 140|Anopheles gambiae lysozyme protein. Length = 140 Score = 23.0 bits (47), Expect = 8.5 Identities = 7/18 (38%), Positives = 10/18 (55%) Frame = +1 Query: 376 RTASTSYGTSQVGSLLWC 429 + ST YG Q+ + WC Sbjct: 64 KNGSTDYGIFQINNKYWC 81 >DQ007317-1|AAY24699.1| 140|Anopheles gambiae lysozyme c-1 protein. Length = 140 Score = 23.0 bits (47), Expect = 8.5 Identities = 7/18 (38%), Positives = 10/18 (55%) Frame = +1 Query: 376 RTASTSYGTSQVGSLLWC 429 + ST YG Q+ + WC Sbjct: 64 KNGSTDYGIFQINNKYWC 81 >DQ004402-1|AAY21241.1| 144|Anopheles gambiae lysozyme c-8 protein. Length = 144 Score = 23.0 bits (47), Expect = 8.5 Identities = 10/32 (31%), Positives = 12/32 (37%) Frame = +1 Query: 367 TAPRTASTSYGTSQVGSLLWCLH*PN*TRRCK 462 T R S YG Q+ + WC CK Sbjct: 60 TKNRDGSKDYGIFQINNYYWCAEGKVGANECK 91 >AY745220-1|AAU93487.1| 101|Anopheles gambiae cytochrome P450 protein. Length = 101 Score = 23.0 bits (47), Expect = 8.5 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = -2 Query: 497 QKLHRHLSVPFHLHRRVQFG 438 QK+H ++S+PF RR G Sbjct: 41 QKIHPYVSLPFGYGRRTCIG 60 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 731,205 Number of Sequences: 2352 Number of extensions: 15652 Number of successful extensions: 39 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 39 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 39 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 65650335 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -