BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10l24 (484 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_01_0192 - 1534013-1535147,1535249-1535370,1535497-1535556,153... 30 0.85 02_05_0232 + 27041793-27042087,27042822-27042943,27043098-270432... 30 0.85 04_03_0243 - 13271384-13272865,13272987-13273248,13274617-13276067 29 2.0 03_05_0871 + 28396964-28399843 27 6.0 02_01_0611 - 4567839-4568144,4568280-4569209,4569301-4569566,456... 27 6.0 >03_01_0192 - 1534013-1535147,1535249-1535370,1535497-1535556, 1535666-1535764,1535839-1535889,1535974-1536175, 1536709-1536911,1537264-1537350,1537435-1537589, 1537640-1537723,1538121-1538325,1538497-1538724 Length = 876 Score = 30.3 bits (65), Expect = 0.85 Identities = 21/61 (34%), Positives = 35/61 (57%), Gaps = 3/61 (4%) Frame = +2 Query: 212 KMEAAREDEYFYKKQKEQLA--NLKGHLNKEIAFHQEQIKRHEDA-IRRHKEQMSDIEKP 382 ++EA +E ++++ A +LK L+K A QE+IKR +A +R+ +EQ I K Sbjct: 328 ELEAQLSEERDLRREERDKAAEDLKSALHKVNAEAQEEIKRQAEAHLRQQREQKEVISKL 387 Query: 383 Q 385 Q Sbjct: 388 Q 388 >02_05_0232 + 27041793-27042087,27042822-27042943,27043098-27043219, 27043601-27043705,27043828-27044257,27044356-27044517, 27044565-27045260,27045349-27046128,27046441-27046654, 27047621-27047981,27047993-27048140,27048276-27048419, 27048784-27048888,27049749-27049794,27050089-27050255, 27050338-27050490,27050654-27050950,27051053-27051220, 27051298-27051363,27051451-27051927,27052031-27052768, 27052935-27053120 Length = 1993 Score = 30.3 bits (65), Expect = 0.85 Identities = 13/36 (36%), Positives = 21/36 (58%) Frame = +2 Query: 236 EYFYKKQKEQLANLKGHLNKEIAFHQEQIKRHEDAI 343 E + +QKE++ K LNK + H +IK HE+ + Sbjct: 1546 EETFARQKEEIQETKRELNKIRSRHMTEIKAHEEKL 1581 >04_03_0243 - 13271384-13272865,13272987-13273248,13274617-13276067 Length = 1064 Score = 29.1 bits (62), Expect = 2.0 Identities = 18/42 (42%), Positives = 22/42 (52%) Frame = -3 Query: 374 QCQTFVLCDA*SHPHVV*SAPGGRQSPCSSAPSGLLVVPFAS 249 QC+ LC + + SAP P SSAPSG + PFAS Sbjct: 85 QCRALELCFNVALNRLPTSAPHS-PPPSSSAPSGAVAPPFAS 125 >03_05_0871 + 28396964-28399843 Length = 959 Score = 27.5 bits (58), Expect = 6.0 Identities = 11/37 (29%), Positives = 20/37 (54%) Frame = +2 Query: 224 AREDEYFYKKQKEQLANLKGHLNKEIAFHQEQIKRHE 334 ARE +FY + + ++ +G + +A H + I HE Sbjct: 521 ARESRFFYCENGDAVSRAEGKYYRRLALHTKLIAFHE 557 >02_01_0611 - 4567839-4568144,4568280-4569209,4569301-4569566, 4569662-4569970,4570497-4570647,4570958-4571012, 4571137-4571512,4571560-4571797,4571878-4572096, 4572629-4572910 Length = 1043 Score = 27.5 bits (58), Expect = 6.0 Identities = 14/45 (31%), Positives = 25/45 (55%) Frame = +2 Query: 248 KKQKEQLANLKGHLNKEIAFHQEQIKRHEDAIRRHKEQMSDIEKP 382 + +KE+L L+ L+K + +K +AIRR + +SD +P Sbjct: 711 QSEKEKLLLLEDVLHKRVIGQDIAVKSVANAIRRSRAGLSDPNRP 755 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,297,439 Number of Sequences: 37544 Number of extensions: 173767 Number of successful extensions: 472 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 462 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 472 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 987904180 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -