BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10l23 (696 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex det... 25 0.69 DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex det... 25 0.69 DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex det... 25 0.69 DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex det... 25 0.91 AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor pr... 24 1.6 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 23 2.8 DQ325082-1|ABD14096.1| 179|Apis mellifera complementary sex det... 22 4.8 AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic ac... 22 4.8 AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex det... 22 4.8 AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex det... 22 4.8 DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholi... 22 6.4 AY736135-1|AAU84701.1| 253|Apis mellifera take-out-like carrier... 22 6.4 AF069739-1|AAC63272.2| 690|Apis mellifera translation initiatio... 22 6.4 AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex det... 21 8.5 AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex det... 21 8.5 AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex det... 21 8.5 AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex det... 21 8.5 AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cycl... 21 8.5 >DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 25.0 bits (52), Expect = 0.69 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = +3 Query: 93 NSNINNCKKRKHDHRIFEHNSNCKLIDLNTN 185 N I+N K+++ +N+NCK + N N Sbjct: 87 NKTIHNNNNYKYNYNNNNYNNNCKKLYYNIN 117 >DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 25.0 bits (52), Expect = 0.69 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = +3 Query: 93 NSNINNCKKRKHDHRIFEHNSNCKLIDLNTN 185 N I+N K+++ +N+NCK + N N Sbjct: 87 NKTIHNNNNYKYNYNNNNYNNNCKKLYYNIN 117 >DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 25.0 bits (52), Expect = 0.69 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = +3 Query: 93 NSNINNCKKRKHDHRIFEHNSNCKLIDLNTN 185 N I+N K+++ +N+NCK + N N Sbjct: 87 NKTIHNNNNYKYNYNNNNYNNNCKKLYYNIN 117 >DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex determiner protein. Length = 186 Score = 24.6 bits (51), Expect = 0.91 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = +3 Query: 93 NSNINNCKKRKHDHRIFEHNSNCKLIDLNTN 185 N I+N K+++ +N+NCK + N N Sbjct: 87 NRTIHNNNNYKYNYNNNNYNNNCKKLYYNIN 117 >AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor protein. Length = 501 Score = 23.8 bits (49), Expect = 1.6 Identities = 12/41 (29%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = +3 Query: 69 EQFFLDKYNSNINNCKKRKHDHRIFE-HNSNCKLIDLNTNA 188 E+F+ +Y INNC+ + + +N + ID+ NA Sbjct: 455 EEFYQSQYGDPINNCEIKAGEIDAERLNNQGIESIDIAANA 495 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 23.0 bits (47), Expect = 2.8 Identities = 8/29 (27%), Positives = 16/29 (55%) Frame = +3 Query: 459 LKNIVVSRQKERAEDAWKQYINELKCKHG 545 +KN+ + +E K Y NE++ ++G Sbjct: 354 MKNVTIVDHHTASESFMKHYENEMRLRNG 382 >DQ325082-1|ABD14096.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 22.2 bits (45), Expect = 4.8 Identities = 9/33 (27%), Positives = 19/33 (57%) Frame = +3 Query: 87 KYNSNINNCKKRKHDHRIFEHNSNCKLIDLNTN 185 K S+++N +++ + +N+NCK + N N Sbjct: 80 KIISSLSNKTIHNNNNYKYNYNNNCKKLYYNIN 112 >AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic acetylcholine Apisa7-2 subunit protein. Length = 461 Score = 22.2 bits (45), Expect = 4.8 Identities = 15/55 (27%), Positives = 26/55 (47%), Gaps = 5/55 (9%) Frame = +3 Query: 366 EKSTYCRPAIDYYSQAFVFKTMSR-----NARLQRLLKNIVVSRQKERAEDAWKQ 515 E+S P++D + + SR +A ++R K + ++ER E WKQ Sbjct: 369 EESNSSSPSLDLGKEGGLEAQWSRVLGRVHATIERNEKRLAEQDRRERMEFDWKQ 423 >AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 22.2 bits (45), Expect = 4.8 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = -1 Query: 78 KTVHRNRSYYSFYKK 34 KT+H N +Y ++ KK Sbjct: 321 KTIHNNNNYKNYNKK 335 >AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 22.2 bits (45), Expect = 4.8 Identities = 7/19 (36%), Positives = 12/19 (63%) Frame = -1 Query: 78 KTVHRNRSYYSFYKKSLKF 22 KT+H N +Y ++ K L + Sbjct: 310 KTIHNNNNYNNYNNKKLYY 328 >DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholine receptor beta1subunit protein. Length = 520 Score = 21.8 bits (44), Expect = 6.4 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = -3 Query: 220 PFESCTSITLFAFVFKSISLQLLLCSKIL 134 P E+ +TL + S+ + LLL SKIL Sbjct: 258 PAEAGEKVTLGISILLSLVVFLLLVSKIL 286 >AY736135-1|AAU84701.1| 253|Apis mellifera take-out-like carrier protein JHBP-1 protein. Length = 253 Score = 21.8 bits (44), Expect = 6.4 Identities = 9/25 (36%), Positives = 12/25 (48%) Frame = +3 Query: 327 ELNEYLIDIGKCAEKSTYCRPAIDY 401 E+ Y ID KC S P +D+ Sbjct: 103 EIKNYNIDWDKCILSSESYNPQVDF 127 >AF069739-1|AAC63272.2| 690|Apis mellifera translation initiation factor 2 protein. Length = 690 Score = 21.8 bits (44), Expect = 6.4 Identities = 8/22 (36%), Positives = 16/22 (72%) Frame = +3 Query: 453 RLLKNIVVSRQKERAEDAWKQY 518 ++L+ ++ RQK+RAE K++ Sbjct: 403 KILQEVIKFRQKQRAEILAKEH 424 >AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 21.4 bits (43), Expect = 8.5 Identities = 7/25 (28%), Positives = 13/25 (52%) Frame = -1 Query: 84 LRKTVHRNRSYYSFYKKSLKFIEAL 10 L T+H N +Y ++ +IE + Sbjct: 308 LNNTIHNNNNYKKLQYYNINYIEQI 332 >AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 21.4 bits (43), Expect = 8.5 Identities = 7/25 (28%), Positives = 13/25 (52%) Frame = -1 Query: 84 LRKTVHRNRSYYSFYKKSLKFIEAL 10 L T+H N +Y ++ +IE + Sbjct: 319 LNNTIHNNNNYKKLQYYNINYIEQI 343 >AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 21.4 bits (43), Expect = 8.5 Identities = 7/25 (28%), Positives = 13/25 (52%) Frame = -1 Query: 84 LRKTVHRNRSYYSFYKKSLKFIEAL 10 L T+H N +Y ++ +IE + Sbjct: 319 LNNTIHNNNNYKKLQYYNINYIEQI 343 >AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 21.4 bits (43), Expect = 8.5 Identities = 7/25 (28%), Positives = 13/25 (52%) Frame = -1 Query: 84 LRKTVHRNRSYYSFYKKSLKFIEAL 10 L T+H N +Y ++ +IE + Sbjct: 308 LNNTIHNNNNYKKLQYYNINYIEQI 332 >AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cyclase beta-3 protein. Length = 832 Score = 21.4 bits (43), Expect = 8.5 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = +3 Query: 366 EKSTYCRPAIDYYSQAF 416 EKS +C +YY+ +F Sbjct: 778 EKSEHCEKGKEYYAASF 794 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 184,413 Number of Sequences: 438 Number of extensions: 4109 Number of successful extensions: 20 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21317625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -