BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10l18 (446 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X98657-1|CAA67226.1| 481|Homo sapiens lipopolysaccharide bindin... 29 7.2 M35533-1|AAA59493.1| 477|Homo sapiens LBP protein. 29 7.2 BC022256-1|AAH22256.1| 477|Homo sapiens LBP protein protein. 29 7.2 AL080249-1|CAC10462.1| 481|Homo sapiens lipopolysaccharide bind... 29 7.2 AF105067-1|AAD21962.1| 481|Homo sapiens lipopolysaccharide-bind... 29 7.2 AF013512-1|AAC39547.1| 481|Homo sapiens lipopolysaccharide bind... 29 7.2 >X98657-1|CAA67226.1| 481|Homo sapiens lipopolysaccharide binding protein protein. Length = 481 Score = 29.1 bits (62), Expect = 7.2 Identities = 12/42 (28%), Positives = 22/42 (52%) Frame = +1 Query: 244 YNKVLVIGVAWFAFSFGMMIYTESLYLNFSPPAQPGPPSDMV 369 +NK++ ++ + F+ ++Y E YLNFS PP + Sbjct: 273 HNKMVYFAISDYVFNTASLVYHEEGYLNFSITDDMIPPDSNI 314 >M35533-1|AAA59493.1| 477|Homo sapiens LBP protein. Length = 477 Score = 29.1 bits (62), Expect = 7.2 Identities = 12/42 (28%), Positives = 22/42 (52%) Frame = +1 Query: 244 YNKVLVIGVAWFAFSFGMMIYTESLYLNFSPPAQPGPPSDMV 369 +NK++ ++ + F+ ++Y E YLNFS PP + Sbjct: 269 HNKMVYFAISDYVFNTASLVYHEEGYLNFSITDDMIPPDSNI 310 >BC022256-1|AAH22256.1| 477|Homo sapiens LBP protein protein. Length = 477 Score = 29.1 bits (62), Expect = 7.2 Identities = 12/42 (28%), Positives = 22/42 (52%) Frame = +1 Query: 244 YNKVLVIGVAWFAFSFGMMIYTESLYLNFSPPAQPGPPSDMV 369 +NK++ ++ + F+ ++Y E YLNFS PP + Sbjct: 273 HNKMVYFAISDYVFNTASLVYHEEGYLNFSITDDMIPPDSNI 314 >AL080249-1|CAC10462.1| 481|Homo sapiens lipopolysaccharide binding protein protein. Length = 481 Score = 29.1 bits (62), Expect = 7.2 Identities = 12/42 (28%), Positives = 22/42 (52%) Frame = +1 Query: 244 YNKVLVIGVAWFAFSFGMMIYTESLYLNFSPPAQPGPPSDMV 369 +NK++ ++ + F+ ++Y E YLNFS PP + Sbjct: 273 HNKMVYFAISDYVFNTASLVYHEEGYLNFSITDDMIPPDSNI 314 >AF105067-1|AAD21962.1| 481|Homo sapiens lipopolysaccharide-binding protein protein. Length = 481 Score = 29.1 bits (62), Expect = 7.2 Identities = 12/42 (28%), Positives = 22/42 (52%) Frame = +1 Query: 244 YNKVLVIGVAWFAFSFGMMIYTESLYLNFSPPAQPGPPSDMV 369 +NK++ ++ + F+ ++Y E YLNFS PP + Sbjct: 273 HNKMVYFAISDYVFNTASLVYHEEGYLNFSITDDMIPPDSNI 314 >AF013512-1|AAC39547.1| 481|Homo sapiens lipopolysaccharide binding protein protein. Length = 481 Score = 29.1 bits (62), Expect = 7.2 Identities = 12/42 (28%), Positives = 22/42 (52%) Frame = +1 Query: 244 YNKVLVIGVAWFAFSFGMMIYTESLYLNFSPPAQPGPPSDMV 369 +NK++ ++ + F+ ++Y E YLNFS PP + Sbjct: 273 HNKMVYFAISDYVFNTASLVYHEEGYLNFSITDDMIPPDSNI 314 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 64,083,212 Number of Sequences: 237096 Number of extensions: 1341454 Number of successful extensions: 7592 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 7361 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7592 length of database: 76,859,062 effective HSP length: 84 effective length of database: 56,942,998 effective search space used: 3644351872 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -