BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10l13 (705 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc fin... 25 0.60 AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. 22 5.6 AM292357-1|CAL23169.2| 355|Tribolium castaneum gustatory recept... 21 9.8 AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription fa... 21 9.8 >AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc finger protein protein. Length = 456 Score = 25.0 bits (52), Expect = 0.60 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +1 Query: 475 KDVKLENGNAPGASNGTSSKSEDNA 549 K VK NGN S+ + S SE+N+ Sbjct: 392 KHVKTHNGNGKKGSSDSCSDSEENS 416 >AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. Length = 712 Score = 21.8 bits (44), Expect = 5.6 Identities = 12/34 (35%), Positives = 15/34 (44%) Frame = -1 Query: 183 CSSWF*FVKSLSFQVFNGILLIARFFLHNARCNN 82 C F V ++ + G LI R F H RC N Sbjct: 671 CHFLFHIVIGMNLIIHVGTQLIYRPFSHFPRCGN 704 >AM292357-1|CAL23169.2| 355|Tribolium castaneum gustatory receptor candidate 36 protein. Length = 355 Score = 21.0 bits (42), Expect = 9.8 Identities = 6/9 (66%), Positives = 9/9 (100%) Frame = +3 Query: 3 VCYEFQNKF 29 VCYE+Q++F Sbjct: 291 VCYEYQDRF 299 >AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription factor protein. Length = 441 Score = 21.0 bits (42), Expect = 9.8 Identities = 7/20 (35%), Positives = 10/20 (50%) Frame = +1 Query: 589 GDPKSDGKAITLSQSDKWMK 648 GDP +TL D W++ Sbjct: 21 GDPTERDLIVTLDDRDLWLR 40 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 155,593 Number of Sequences: 336 Number of extensions: 3041 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18634795 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -