BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10l10 (609 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292370-1|CAL23182.1| 418|Tribolium castaneum gustatory recept... 23 2.7 AM292359-1|CAL23171.2| 436|Tribolium castaneum gustatory recept... 22 3.5 AY043293-2|AAK96034.1| 353|Tribolium castaneum homeodomain tran... 21 6.1 AF231104-1|AAF64149.1| 142|Tribolium castaneum labial protein p... 21 6.1 AF231103-1|AAF64148.1| 142|Tribolium castaneum labial protein p... 21 6.1 >AM292370-1|CAL23182.1| 418|Tribolium castaneum gustatory receptor candidate 49 protein. Length = 418 Score = 22.6 bits (46), Expect = 2.7 Identities = 14/42 (33%), Positives = 21/42 (50%) Frame = -1 Query: 603 STFLYFKWYIFIK*LLPKLQNTLKTNLI*KLKWKLLTRSLYP 478 +T+L Y+ +K PK+ KT L L +KLL +P Sbjct: 27 NTYLVLNKYLLVKHSKPKMPLLPKTPLPLTLLYKLLGIIQFP 68 >AM292359-1|CAL23171.2| 436|Tribolium castaneum gustatory receptor candidate 38 protein. Length = 436 Score = 22.2 bits (45), Expect = 3.5 Identities = 9/30 (30%), Positives = 16/30 (53%) Frame = -3 Query: 526 PYIKTKMEIVDQIFVSFQGVIQITIYCYNN 437 P + + +V I ++ +IQ+ YCY N Sbjct: 193 PLLACGVMVVTHITMAHFKIIQVVPYCYIN 222 >AY043293-2|AAK96034.1| 353|Tribolium castaneum homeodomain transcription factor Labialprotein. Length = 353 Score = 21.4 bits (43), Expect = 6.1 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = +2 Query: 464 NYTLKGYKDLVNNFHFSFYI 523 N+T K +L FHF+ Y+ Sbjct: 259 NFTNKQLTELEKEFHFNKYL 278 >AF231104-1|AAF64149.1| 142|Tribolium castaneum labial protein protein. Length = 142 Score = 21.4 bits (43), Expect = 6.1 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = +2 Query: 464 NYTLKGYKDLVNNFHFSFYI 523 N+T K +L FHF+ Y+ Sbjct: 48 NFTNKQLTELEKEFHFNKYL 67 >AF231103-1|AAF64148.1| 142|Tribolium castaneum labial protein protein. Length = 142 Score = 21.4 bits (43), Expect = 6.1 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = +2 Query: 464 NYTLKGYKDLVNNFHFSFYI 523 N+T K +L FHF+ Y+ Sbjct: 48 NFTNKQLTELEKEFHFNKYL 67 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 132,511 Number of Sequences: 336 Number of extensions: 2754 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15457268 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -