BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10l10 (609 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_1468 + 33811471-33811657,33811888-33811980,33812899-338130... 28 6.7 01_05_0484 - 22621614-22621676,22621798-22621911,22622006-226224... 28 6.7 >04_04_1468 + 33811471-33811657,33811888-33811980,33812899-33813027, 33813089-33813166,33813377-33813435,33813522-33813644, 33814225-33814282,33814383-33814468,33814564-33814635 Length = 294 Score = 27.9 bits (59), Expect = 6.7 Identities = 15/44 (34%), Positives = 25/44 (56%) Frame = +2 Query: 458 YLNYTLKGYKDLVNNFHFSFYIRFVFNVFCNLGSNYLIKMYHLK 589 YL+ ++G L N ++++ VFN+ NL N LIK + +K Sbjct: 203 YLDLVIEGKLPL--NHEILYHLQDVFNLLPNLNVNELIKAFAVK 244 >01_05_0484 - 22621614-22621676,22621798-22621911,22622006-22622453, 22623052-22623179,22623747-22623821,22623954-22624040 Length = 304 Score = 27.9 bits (59), Expect = 6.7 Identities = 15/39 (38%), Positives = 24/39 (61%), Gaps = 1/39 (2%) Frame = +1 Query: 205 KRSREDDTCEFMP-LSKRINNLHINNGLVNTSASQSRDS 318 KR R +DT P +KR NNL +N+G V S+++ ++ Sbjct: 171 KRKRANDTTSEEPDNTKRQNNLSVNSGEVVQSSNEEAET 209 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,123,148 Number of Sequences: 37544 Number of extensions: 229914 Number of successful extensions: 336 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 332 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 336 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1454766756 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -