BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10l09 (443 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF069739-1|AAC63272.2| 690|Apis mellifera translation initiatio... 24 0.65 AY898652-1|AAX83121.1| 349|Apis mellifera AKH receptor protein. 23 1.5 AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 23 2.0 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 23 2.0 AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 22 3.5 AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 21 6.1 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 21 6.1 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 21 6.1 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 21 6.1 AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 21 6.1 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 21 6.1 AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. 21 6.1 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 21 6.1 L10710-1|AAA27730.1| 382|Apis mellifera hyaluronidase protein. 21 8.0 >AF069739-1|AAC63272.2| 690|Apis mellifera translation initiation factor 2 protein. Length = 690 Score = 24.2 bits (50), Expect = 0.65 Identities = 14/37 (37%), Positives = 21/37 (56%) Frame = -2 Query: 184 AVKNIPIPSNKKVRCGKTAGFIGDVYRIIDSISRLIF 74 A K I +NKK G + F VY++ID+I + I+ Sbjct: 541 ATKQIKDEANKK---GVSLRFYNVVYKLIDNIKKEIY 574 >AY898652-1|AAX83121.1| 349|Apis mellifera AKH receptor protein. Length = 349 Score = 23.0 bits (47), Expect = 1.5 Identities = 14/56 (25%), Positives = 26/56 (46%) Frame = +1 Query: 202 KLQVLKPQEICSKSYFYHWWPPYFLVSEFYSCCYG*GFMCDINVRYNLSYE*CNNT 369 K++ LK I + F+ W PY+++S +Y + D ++ L C N+ Sbjct: 255 KIRTLKMTVIII-AVFFICWTPYYVMSLWYWIDRNSAYKIDQRIQKGLFLFACTNS 309 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 22.6 bits (46), Expect = 2.0 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = +2 Query: 2 IPQSLSLSSFIGFVFYS 52 IP++ + S FIGF Y+ Sbjct: 698 IPENFNESKFIGFTMYT 714 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 22.6 bits (46), Expect = 2.0 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = +2 Query: 2 IPQSLSLSSFIGFVFYS 52 IP++ + S FIGF Y+ Sbjct: 788 IPENFNESKFIGFTMYT 804 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 21.8 bits (44), Expect = 3.5 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = -1 Query: 200 VNEEPGREEYSYSEQQKG*MWKNCRVY 120 + E RE YS S +++ +KN R Y Sbjct: 263 LEERTSRERYSRSREREQKSYKNEREY 289 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.0 bits (42), Expect = 6.1 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = -2 Query: 67 ILERNTIKNKTNKTRQ 20 I ER IKN NKT + Sbjct: 170 IFEREEIKNILNKTNE 185 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.0 bits (42), Expect = 6.1 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = -2 Query: 67 ILERNTIKNKTNKTRQ 20 I ER IKN NKT + Sbjct: 170 IFEREEIKNILNKTNE 185 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.0 bits (42), Expect = 6.1 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = -2 Query: 67 ILERNTIKNKTNKTRQ 20 I ER IKN NKT + Sbjct: 170 IFEREEIKNILNKTNE 185 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.0 bits (42), Expect = 6.1 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = -2 Query: 67 ILERNTIKNKTNKTRQ 20 I ER IKN NKT + Sbjct: 170 IFEREEIKNILNKTNE 185 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.0 bits (42), Expect = 6.1 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = -2 Query: 67 ILERNTIKNKTNKTRQ 20 I ER IKN NKT + Sbjct: 170 IFEREEIKNILNKTNE 185 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.0 bits (42), Expect = 6.1 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = -2 Query: 67 ILERNTIKNKTNKTRQ 20 I ER IKN NKT + Sbjct: 170 IFEREEIKNILNKTNE 185 >AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. Length = 400 Score = 21.0 bits (42), Expect = 6.1 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = -2 Query: 67 ILERNTIKNKTNKTRQ 20 I ER IKN NKT + Sbjct: 170 IFEREEIKNILNKTNE 185 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 21.0 bits (42), Expect = 6.1 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = -2 Query: 67 ILERNTIKNKTNKTRQ 20 I ER IKN NKT + Sbjct: 170 IFEREEIKNILNKTNE 185 >L10710-1|AAA27730.1| 382|Apis mellifera hyaluronidase protein. Length = 382 Score = 20.6 bits (41), Expect = 8.0 Identities = 8/21 (38%), Positives = 11/21 (52%) Frame = -3 Query: 117 ATCTGSLIQFRDSFLWLF*NE 55 A C + +Q D WLF +E Sbjct: 231 AQCEATTMQENDKMSWLFESE 251 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 119,082 Number of Sequences: 438 Number of extensions: 2593 Number of successful extensions: 14 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 11574126 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -