BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10l08 (683 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X99250-1|CAA67623.1| 436|Homo sapiens ET-B receptor protein. 32 2.2 S57283-1|AAB25531.1| 442|Homo sapiens endothelin ET-B receptor ... 32 2.2 S44866-1|AAB19411.1| 442|Homo sapiens ETB endothelin receptor p... 32 2.2 M74921-1|AAA58465.1| 442|Homo sapiens endothelin receptor protein. 32 2.2 L06623-1|AAA52342.1| 442|Homo sapiens endothelin receptor type ... 32 2.2 D90402-1|BAA14398.1| 442|Homo sapiens endothelin receptor protein. 32 2.2 D13168-1|BAA02445.1| 442|Homo sapiens endothelin-B receptor pro... 32 2.2 BC014472-1|AAH14472.1| 442|Homo sapiens EDNRB protein protein. 32 2.2 AY547312-1|AAS38516.1| 442|Homo sapiens endothelin receptor typ... 32 2.2 AY275463-1|AAP32295.1| 442|Homo sapiens endothelin receptor typ... 32 2.2 AL139002-2|CAH72430.1| 532|Homo sapiens endothelin receptor typ... 32 2.2 AL139002-1|CAM16893.1| 442|Homo sapiens endothelin receptor typ... 32 2.2 AF114165-1|AAD24541.1| 531|Homo sapiens endothelin receptor B d... 32 2.2 AB209198-1|BAD92435.1| 459|Homo sapiens endothelin receptor typ... 32 2.2 >X99250-1|CAA67623.1| 436|Homo sapiens ET-B receptor protein. Length = 436 Score = 31.9 bits (69), Expect = 2.2 Identities = 14/34 (41%), Positives = 24/34 (70%) Frame = -2 Query: 496 FKTLSSIVSKVLYITSSINNSTRLRIRNKNKTLQ 395 FK ++++VS ++++ I NST LRI KNK ++ Sbjct: 100 FKYINTVVSCLVFVLGIIGNSTLLRIIYKNKCMR 133 >S57283-1|AAB25531.1| 442|Homo sapiens endothelin ET-B receptor protein. Length = 442 Score = 31.9 bits (69), Expect = 2.2 Identities = 14/34 (41%), Positives = 24/34 (70%) Frame = -2 Query: 496 FKTLSSIVSKVLYITSSINNSTRLRIRNKNKTLQ 395 FK ++++VS ++++ I NST LRI KNK ++ Sbjct: 100 FKYINTVVSCLVFVLGIIGNSTLLRIIYKNKCMR 133 >S44866-1|AAB19411.1| 442|Homo sapiens ETB endothelin receptor protein. Length = 442 Score = 31.9 bits (69), Expect = 2.2 Identities = 14/34 (41%), Positives = 24/34 (70%) Frame = -2 Query: 496 FKTLSSIVSKVLYITSSINNSTRLRIRNKNKTLQ 395 FK ++++VS ++++ I NST LRI KNK ++ Sbjct: 100 FKYINTVVSCLVFVLGIIGNSTLLRIIYKNKCMR 133 >M74921-1|AAA58465.1| 442|Homo sapiens endothelin receptor protein. Length = 442 Score = 31.9 bits (69), Expect = 2.2 Identities = 14/34 (41%), Positives = 24/34 (70%) Frame = -2 Query: 496 FKTLSSIVSKVLYITSSINNSTRLRIRNKNKTLQ 395 FK ++++VS ++++ I NST LRI KNK ++ Sbjct: 100 FKYINTVVSCLVFVLGIIGNSTLLRIIYKNKCMR 133 >L06623-1|AAA52342.1| 442|Homo sapiens endothelin receptor type B protein. Length = 442 Score = 31.9 bits (69), Expect = 2.2 Identities = 14/34 (41%), Positives = 24/34 (70%) Frame = -2 Query: 496 FKTLSSIVSKVLYITSSINNSTRLRIRNKNKTLQ 395 FK ++++VS ++++ I NST LRI KNK ++ Sbjct: 100 FKYINTVVSCLVFVLGIIGNSTLLRIIYKNKCMR 133 >D90402-1|BAA14398.1| 442|Homo sapiens endothelin receptor protein. Length = 442 Score = 31.9 bits (69), Expect = 2.2 Identities = 14/34 (41%), Positives = 24/34 (70%) Frame = -2 Query: 496 FKTLSSIVSKVLYITSSINNSTRLRIRNKNKTLQ 395 FK ++++VS ++++ I NST LRI KNK ++ Sbjct: 100 FKYINTVVSCLVFVLGIIGNSTLLRIIYKNKCMR 133 >D13168-1|BAA02445.1| 442|Homo sapiens endothelin-B receptor protein. Length = 442 Score = 31.9 bits (69), Expect = 2.2 Identities = 14/34 (41%), Positives = 24/34 (70%) Frame = -2 Query: 496 FKTLSSIVSKVLYITSSINNSTRLRIRNKNKTLQ 395 FK ++++VS ++++ I NST LRI KNK ++ Sbjct: 100 FKYINTVVSCLVFVLGIIGNSTLLRIIYKNKCMR 133 >BC014472-1|AAH14472.1| 442|Homo sapiens EDNRB protein protein. Length = 442 Score = 31.9 bits (69), Expect = 2.2 Identities = 14/34 (41%), Positives = 24/34 (70%) Frame = -2 Query: 496 FKTLSSIVSKVLYITSSINNSTRLRIRNKNKTLQ 395 FK ++++VS ++++ I NST LRI KNK ++ Sbjct: 100 FKYINTVVSCLVFVLGIIGNSTLLRIIYKNKCMR 133 >AY547312-1|AAS38516.1| 442|Homo sapiens endothelin receptor type B protein. Length = 442 Score = 31.9 bits (69), Expect = 2.2 Identities = 14/34 (41%), Positives = 24/34 (70%) Frame = -2 Query: 496 FKTLSSIVSKVLYITSSINNSTRLRIRNKNKTLQ 395 FK ++++VS ++++ I NST LRI KNK ++ Sbjct: 100 FKYINTVVSCLVFVLGIIGNSTLLRIIYKNKCMR 133 >AY275463-1|AAP32295.1| 442|Homo sapiens endothelin receptor type B protein. Length = 442 Score = 31.9 bits (69), Expect = 2.2 Identities = 14/34 (41%), Positives = 24/34 (70%) Frame = -2 Query: 496 FKTLSSIVSKVLYITSSINNSTRLRIRNKNKTLQ 395 FK ++++VS ++++ I NST LRI KNK ++ Sbjct: 100 FKYINTVVSCLVFVLGIIGNSTLLRIIYKNKCMR 133 >AL139002-2|CAH72430.1| 532|Homo sapiens endothelin receptor type B protein. Length = 532 Score = 31.9 bits (69), Expect = 2.2 Identities = 14/34 (41%), Positives = 24/34 (70%) Frame = -2 Query: 496 FKTLSSIVSKVLYITSSINNSTRLRIRNKNKTLQ 395 FK ++++VS ++++ I NST LRI KNK ++ Sbjct: 190 FKYINTVVSCLVFVLGIIGNSTLLRIIYKNKCMR 223 >AL139002-1|CAM16893.1| 442|Homo sapiens endothelin receptor type B protein. Length = 442 Score = 31.9 bits (69), Expect = 2.2 Identities = 14/34 (41%), Positives = 24/34 (70%) Frame = -2 Query: 496 FKTLSSIVSKVLYITSSINNSTRLRIRNKNKTLQ 395 FK ++++VS ++++ I NST LRI KNK ++ Sbjct: 100 FKYINTVVSCLVFVLGIIGNSTLLRIIYKNKCMR 133 >AF114165-1|AAD24541.1| 531|Homo sapiens endothelin receptor B delta 3 protein. Length = 531 Score = 31.9 bits (69), Expect = 2.2 Identities = 14/34 (41%), Positives = 24/34 (70%) Frame = -2 Query: 496 FKTLSSIVSKVLYITSSINNSTRLRIRNKNKTLQ 395 FK ++++VS ++++ I NST LRI KNK ++ Sbjct: 189 FKYINTVVSCLVFVLGIIGNSTLLRIIYKNKCMR 222 >AB209198-1|BAD92435.1| 459|Homo sapiens endothelin receptor type B isoform 1 variant protein. Length = 459 Score = 31.9 bits (69), Expect = 2.2 Identities = 14/34 (41%), Positives = 24/34 (70%) Frame = -2 Query: 496 FKTLSSIVSKVLYITSSINNSTRLRIRNKNKTLQ 395 FK ++++VS ++++ I NST LRI KNK ++ Sbjct: 117 FKYINTVVSCLVFVLGIIGNSTLLRIIYKNKCMR 150 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 80,574,992 Number of Sequences: 237096 Number of extensions: 1387286 Number of successful extensions: 1934 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 1851 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1934 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 7783251346 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -