BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10l08 (683 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U40946-2|AAO91682.1| 780|Caenorhabditis elegans Hypothetical pr... 31 0.77 AL021447-2|CAA16273.2| 807|Caenorhabditis elegans Hypothetical ... 27 9.4 >U40946-2|AAO91682.1| 780|Caenorhabditis elegans Hypothetical protein W05H9.4 protein. Length = 780 Score = 31.1 bits (67), Expect = 0.77 Identities = 14/36 (38%), Positives = 20/36 (55%) Frame = +2 Query: 179 KYFCTDDFLCSSDILNLFHNILFLTKGPKYIYFAMV 286 KY CT + DI L H+I+ TKG +Y Y+ + Sbjct: 234 KYLCTSR-IAQMDITTLRHDIIAATKGKEYKYYTHI 268 >AL021447-2|CAA16273.2| 807|Caenorhabditis elegans Hypothetical protein F19B2.6 protein. Length = 807 Score = 27.5 bits (58), Expect = 9.4 Identities = 12/37 (32%), Positives = 21/37 (56%) Frame = -2 Query: 481 SIVSKVLYITSSINNSTRLRIRNKNKTLQWPRLQTRK 371 +I+SKV Y+ + N +LR+ + QW + +T K Sbjct: 644 NIISKVDYLMKTDRNLKKLRMAKEVSEKQWEQFETDK 680 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,981,627 Number of Sequences: 27780 Number of extensions: 279157 Number of successful extensions: 512 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 486 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 512 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1560745544 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -