BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10l05 (671 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY353563-1|AAQ57599.1| 1132|Anopheles gambiae relish protein. 26 0.94 CR954257-6|CAJ14157.1| 375|Anopheles gambiae RrnaAD, ribosomal ... 23 6.6 U42429-1|AAB54088.1| 596|Anopheles gambiae engrailed protein. 23 8.8 U42214-1|AAB58461.1| 596|Anopheles gambiae engrailed protein. 23 8.8 AF513635-1|AAM53607.1| 212|Anopheles gambiae glutathione S-tran... 23 8.8 >AY353563-1|AAQ57599.1| 1132|Anopheles gambiae relish protein. Length = 1132 Score = 26.2 bits (55), Expect = 0.94 Identities = 22/77 (28%), Positives = 31/77 (40%), Gaps = 5/77 (6%) Frame = +3 Query: 63 IQNFQVTNRRVNKINVNN--GFSSEEGCFDEKCVVLKMHQGASF---DFRGHQEKHRAVI 227 + +Q+ ++ N N G C E V + GA D+RG+ HRAV+ Sbjct: 767 LHEYQLAEELLDLPNDRNETGLHLAVSCNSEPIVKALLGAGAKLHYCDYRGNTPLHRAVV 826 Query: 228 GGPKRRVRLRDLAPGTR 278 VRL L G R Sbjct: 827 ENVPDMVRLLLLQGGLR 843 >CR954257-6|CAJ14157.1| 375|Anopheles gambiae RrnaAD, ribosomal RNA adenine dimethylaseprotein. Length = 375 Score = 23.4 bits (48), Expect = 6.6 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = +1 Query: 256 ETWRPGRGDQLVSWRNYAEKKDEKKE 333 E W P G +L+ NY K KK+ Sbjct: 251 EHWIPHCGARLILNSNYTRKSSSKKD 276 >U42429-1|AAB54088.1| 596|Anopheles gambiae engrailed protein. Length = 596 Score = 23.0 bits (47), Expect = 8.8 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = +3 Query: 555 TMRPLPKPVPMP 590 T +P PKP+P P Sbjct: 414 TAKPTPKPIPKP 425 >U42214-1|AAB58461.1| 596|Anopheles gambiae engrailed protein. Length = 596 Score = 23.0 bits (47), Expect = 8.8 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = +3 Query: 555 TMRPLPKPVPMP 590 T +P PKP+P P Sbjct: 414 TAKPTPKPIPKP 425 >AF513635-1|AAM53607.1| 212|Anopheles gambiae glutathione S-transferase D4 protein. Length = 212 Score = 23.0 bits (47), Expect = 8.8 Identities = 13/34 (38%), Positives = 18/34 (52%) Frame = -1 Query: 227 NNGAVLFLVPAEVKARPLMHFKNDTFFVKTAFLR 126 +NG V+F A V M+ KND + K A +R Sbjct: 56 DNGTVVFEPCAIVLYLVEMYAKNDALYPKDALVR 89 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 501,697 Number of Sequences: 2352 Number of extensions: 8653 Number of successful extensions: 30 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 27 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 30 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 67322955 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -