BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10k24 (660 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12284| Best HMM Match : ATP-synt_ab (HMM E-Value=0) 98 6e-21 SB_7724| Best HMM Match : ATP-synt_ab_C (HMM E-Value=0) 88 7e-18 SB_26832| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.9 SB_35834| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_25799| Best HMM Match : DUF618 (HMM E-Value=2e-26) 29 4.4 SB_5325| Best HMM Match : Drf_FH1 (HMM E-Value=0.41) 29 4.4 SB_26407| Best HMM Match : UQ_con (HMM E-Value=0) 29 4.4 SB_10311| Best HMM Match : S-antigen (HMM E-Value=0.73) 29 4.4 SB_39538| Best HMM Match : VWA (HMM E-Value=0) 28 5.9 SB_15652| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.9 SB_5453| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.7 >SB_12284| Best HMM Match : ATP-synt_ab (HMM E-Value=0) Length = 238 Score = 97.9 bits (233), Expect = 6e-21 Identities = 61/113 (53%), Positives = 75/113 (66%), Gaps = 18/113 (15%) Frame = +2 Query: 350 LDRVTLAEHFRD----EEGQDLLLFIDNIFRFTQAGSEV-----RTRSSYQFE------- 481 L +T+AE+FRD +G+D+L F+DNIFRFTQAGSEV R S+ ++ Sbjct: 125 LSGLTIAEYFRDGAGEAQGKDVLFFVDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEM 184 Query: 482 -GRGGRFT-VKLSLRSNLKAVYVPADDLTDPAPATTFAHLDATTVLSPAIAEL 634 R T K ++++AVYVPADDLTDPAPATTFAHLDATTVLS IAEL Sbjct: 185 GAMQERITSTKKGSITSVQAVYVPADDLTDPAPATTFAHLDATTVLSRKIAEL 237 Score = 37.9 bits (84), Expect = 0.007 Identities = 16/25 (64%), Positives = 22/25 (88%) Frame = +3 Query: 285 ETRASLVYGQKDEPHGARARVALTG 359 E++A+ V+GQ +EP GARARVAL+G Sbjct: 103 ESKATFVFGQMNEPPGARARVALSG 127 >SB_7724| Best HMM Match : ATP-synt_ab_C (HMM E-Value=0) Length = 448 Score = 87.8 bits (208), Expect = 7e-18 Identities = 40/53 (75%), Positives = 46/53 (86%) Frame = +2 Query: 500 TVKLSLRSNLKAVYVPADDLTDPAPATTFAHLDATTVLSPAIAELGVYPAVDP 658 T K ++++A+YVPADDLTDPAPATTFAHLDATTVLS IAELG+YPAVDP Sbjct: 268 TTKKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRGIAELGIYPAVDP 320 >SB_26832| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 635 Score = 29.9 bits (64), Expect = 1.9 Identities = 17/27 (62%), Positives = 18/27 (66%), Gaps = 2/27 (7%) Frame = -1 Query: 348 PPGHA-PRGAHPSGR-IPGTPGSPART 274 PPG A P G PSGR +PG PG P RT Sbjct: 478 PPGPAGPPG--PSGRYVPGPPGPPGRT 502 >SB_35834| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 29.1 bits (62), Expect = 3.4 Identities = 14/31 (45%), Positives = 16/31 (51%), Gaps = 5/31 (16%) Frame = +1 Query: 577 YDLRSLRRDHGPLARHR-----GAGCISGGG 654 Y+LR +R H P R R G GC GGG Sbjct: 16 YNLRKRKRSHSPAQRRRSGGGGGGGCEGGGG 46 >SB_25799| Best HMM Match : DUF618 (HMM E-Value=2e-26) Length = 687 Score = 28.7 bits (61), Expect = 4.4 Identities = 12/30 (40%), Positives = 14/30 (46%) Frame = -1 Query: 351 RPPGHAPRGAHPSGRIPGTPGSPARTPAKI 262 RPP R H GR P PG P P ++ Sbjct: 387 RPPHEPGRPPHELGRPPHEPGRPPHEPGRL 416 Score = 28.3 bits (60), Expect = 5.9 Identities = 12/31 (38%), Positives = 14/31 (45%) Frame = -1 Query: 357 RSRPPGHAPRGAHPSGRIPGTPGSPARTPAK 265 + RPP R H GR P PG P P + Sbjct: 322 QGRPPYEPGRPPHEPGRPPHEPGRPPHEPGR 352 Score = 28.3 bits (60), Expect = 5.9 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = -1 Query: 351 RPPGHAPRGAHPSGRIPGTPGSPARTPAK 265 RPP R H GR P PG P P + Sbjct: 331 RPPHEPGRPPHEPGRPPHEPGRPPHEPGR 359 Score = 28.3 bits (60), Expect = 5.9 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = -1 Query: 351 RPPGHAPRGAHPSGRIPGTPGSPARTPAK 265 RPP R H GR P PG P P + Sbjct: 338 RPPHEPGRPPHEPGRPPHEPGRPPHEPGR 366 Score = 28.3 bits (60), Expect = 5.9 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = -1 Query: 351 RPPGHAPRGAHPSGRIPGTPGSPARTPAK 265 RPP R H GR P PG P P + Sbjct: 345 RPPHEPGRPPHEPGRPPHEPGRPPHEPGR 373 Score = 28.3 bits (60), Expect = 5.9 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = -1 Query: 351 RPPGHAPRGAHPSGRIPGTPGSPARTPAK 265 RPP R H GR P PG P P + Sbjct: 352 RPPHEPGRPPHEPGRPPHEPGRPPHEPGR 380 Score = 27.9 bits (59), Expect = 7.7 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = -1 Query: 351 RPPGHAPRGAHPSGRIPGTPGSPARTPAK 265 RPP R H GR P PG P P + Sbjct: 366 RPPHEPGRPPHEPGRPPYEPGRPPHEPGR 394 >SB_5325| Best HMM Match : Drf_FH1 (HMM E-Value=0.41) Length = 638 Score = 28.7 bits (61), Expect = 4.4 Identities = 17/39 (43%), Positives = 21/39 (53%), Gaps = 3/39 (7%) Frame = +1 Query: 235 PQ*SRVPRSNLRRSTSWRPGR--PW-YTARRMSPTGRVP 342 PQ R+P + R SW P R P+ T RR+SP R P Sbjct: 208 PQKERIPHQSPERLPSWSPVRQSPFNKTHRRLSPPRRSP 246 >SB_26407| Best HMM Match : UQ_con (HMM E-Value=0) Length = 1282 Score = 28.7 bits (61), Expect = 4.4 Identities = 12/30 (40%), Positives = 14/30 (46%) Frame = -1 Query: 351 RPPGHAPRGAHPSGRIPGTPGSPARTPAKI 262 RPP R H GR P PG P P ++ Sbjct: 153 RPPHEPGRPPHELGRPPHEPGRPPHEPGRL 182 Score = 28.3 bits (60), Expect = 5.9 Identities = 12/31 (38%), Positives = 14/31 (45%) Frame = -1 Query: 357 RSRPPGHAPRGAHPSGRIPGTPGSPARTPAK 265 + RPP R H GR P PG P P + Sbjct: 88 QGRPPYEPGRPPHEPGRPPHEPGRPPHEPGR 118 Score = 28.3 bits (60), Expect = 5.9 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = -1 Query: 351 RPPGHAPRGAHPSGRIPGTPGSPARTPAK 265 RPP R H GR P PG P P + Sbjct: 97 RPPHEPGRPPHEPGRPPHEPGRPPHEPGR 125 Score = 28.3 bits (60), Expect = 5.9 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = -1 Query: 351 RPPGHAPRGAHPSGRIPGTPGSPARTPAK 265 RPP R H GR P PG P P + Sbjct: 104 RPPHEPGRPPHEPGRPPHEPGRPPHEPGR 132 Score = 28.3 bits (60), Expect = 5.9 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = -1 Query: 351 RPPGHAPRGAHPSGRIPGTPGSPARTPAK 265 RPP R H GR P PG P P + Sbjct: 111 RPPHEPGRPPHEPGRPPHEPGRPPHEPGR 139 Score = 28.3 bits (60), Expect = 5.9 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = -1 Query: 351 RPPGHAPRGAHPSGRIPGTPGSPARTPAK 265 RPP R H GR P PG P P + Sbjct: 118 RPPHEPGRPPHEPGRPPHEPGRPPHEPGR 146 Score = 27.9 bits (59), Expect = 7.7 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = -1 Query: 351 RPPGHAPRGAHPSGRIPGTPGSPARTPAK 265 RPP R H GR P PG P P + Sbjct: 132 RPPHEPGRPPHEPGRPPYEPGRPPHEPGR 160 >SB_10311| Best HMM Match : S-antigen (HMM E-Value=0.73) Length = 617 Score = 28.7 bits (61), Expect = 4.4 Identities = 15/26 (57%), Positives = 18/26 (69%) Frame = -1 Query: 354 SRPPGHAPRGAHPSGRIPGTPGSPAR 277 S+P G A RGA P+GR T G+PAR Sbjct: 330 SKPGGVAARGA-PAGRGAATRGAPAR 354 >SB_39538| Best HMM Match : VWA (HMM E-Value=0) Length = 3208 Score = 28.3 bits (60), Expect = 5.9 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = -2 Query: 398 PGPPRLGSAQPRSPGQGHPGTRPVGL 321 PG P GS P SPG G PG+ G+ Sbjct: 1356 PGFPSPGSGIPGSPGSGIPGSPGSGI 1381 >SB_15652| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 689 Score = 28.3 bits (60), Expect = 5.9 Identities = 12/35 (34%), Positives = 17/35 (48%) Frame = -1 Query: 351 RPPGHAPRGAHPSGRIPGTPGSPARTPAKITSRNS 247 +PPG P+ H + PG G RTP + N+ Sbjct: 583 QPPGKVPQPPHTTPLAPGMGGERGRTPNADLTHNA 617 >SB_5453| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2578 Score = 27.9 bits (59), Expect = 7.7 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = -3 Query: 313 WPYTRDARVSSSYSGEDYFEELLIIAAHI 227 WP+ R R SS +GED +L + H+ Sbjct: 2435 WPHWRRTRRSSGVAGEDNLYDLYAVCNHL 2463 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,461,855 Number of Sequences: 59808 Number of extensions: 302384 Number of successful extensions: 2508 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 2290 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2500 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1693527500 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -