BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10k24 (660 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 23 2.0 DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholi... 23 3.4 DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholi... 23 3.4 AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 22 6.0 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 22 6.0 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 23.4 bits (48), Expect = 2.0 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -2 Query: 410 TTVSPGPPRLGSAQPRSPGQGHP 342 T +SP +L S+QP P Q +P Sbjct: 805 TILSPVREKLSSSQPMQPPQQNP 827 >DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 22.6 bits (46), Expect = 3.4 Identities = 17/66 (25%), Positives = 27/66 (40%), Gaps = 3/66 (4%) Frame = +2 Query: 359 VTLAEHFRDEEGQDLLLFIDNIFRFTQAGSEVRTRSSYQFEGR---GGRFTVKLSLRSNL 529 V L HFR + + ++ +F V R Y+FE GR ++ ++R Sbjct: 327 VVLNVHFRSPQTHKMAPWVKRVFIHILPRLLVMRRPQYKFETNRYSSGRVLMR-TVRGKE 385 Query: 530 KAVYVP 547 K Y P Sbjct: 386 KTCYYP 391 >DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 22.6 bits (46), Expect = 3.4 Identities = 17/66 (25%), Positives = 27/66 (40%), Gaps = 3/66 (4%) Frame = +2 Query: 359 VTLAEHFRDEEGQDLLLFIDNIFRFTQAGSEVRTRSSYQFEGR---GGRFTVKLSLRSNL 529 V L HFR + + ++ +F V R Y+FE GR ++ ++R Sbjct: 327 VVLNVHFRSPQTHKMAPWVKRVFIHILPRLLVMRRPQYKFETNRYSSGRVLMR-TVRGKE 385 Query: 530 KAVYVP 547 K Y P Sbjct: 386 KTCYYP 391 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 21.8 bits (44), Expect = 6.0 Identities = 8/26 (30%), Positives = 11/26 (42%) Frame = -3 Query: 346 TRARAPWGSSFWPYTRDARVSSSYSG 269 T R PW S +W D + +G Sbjct: 274 TNRRNPWFSEYWEEVFDCLLKKERNG 299 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 21.8 bits (44), Expect = 6.0 Identities = 8/26 (30%), Positives = 11/26 (42%) Frame = -3 Query: 346 TRARAPWGSSFWPYTRDARVSSSYSG 269 T R PW S +W D + +G Sbjct: 364 TNRRNPWFSEYWEEVFDCLLKKERNG 389 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 146,665 Number of Sequences: 438 Number of extensions: 2999 Number of successful extensions: 12 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 19855845 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -