BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10k22 (687 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EU019709-1|ABU25221.1| 540|Tribolium castaneum aspartate 1-deca... 21 9.5 AM292374-1|CAL23186.2| 659|Tribolium castaneum gustatory recept... 21 9.5 AM292345-1|CAL23157.2| 384|Tribolium castaneum gustatory recept... 21 9.5 AM292322-1|CAL23134.1| 373|Tribolium castaneum gustatory recept... 21 9.5 >EU019709-1|ABU25221.1| 540|Tribolium castaneum aspartate 1-decarboxylase protein. Length = 540 Score = 21.0 bits (42), Expect = 9.5 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = -1 Query: 69 ILKCTKIC*KFKVWLVV 19 I K +C K+K+WL V Sbjct: 303 IEKIADVCQKYKLWLHV 319 >AM292374-1|CAL23186.2| 659|Tribolium castaneum gustatory receptor candidate 53 protein. Length = 659 Score = 21.0 bits (42), Expect = 9.5 Identities = 7/16 (43%), Positives = 11/16 (68%) Frame = -3 Query: 103 FAESSLKFCINHFKMY 56 F SSL+FC+N ++ Sbjct: 312 FRPSSLRFCLNILSIF 327 >AM292345-1|CAL23157.2| 384|Tribolium castaneum gustatory receptor candidate 24 protein. Length = 384 Score = 21.0 bits (42), Expect = 9.5 Identities = 7/16 (43%), Positives = 11/16 (68%) Frame = -3 Query: 103 FAESSLKFCINHFKMY 56 F SSL+FC+N ++ Sbjct: 37 FRPSSLRFCLNILSIF 52 >AM292322-1|CAL23134.1| 373|Tribolium castaneum gustatory receptor candidate 1 protein. Length = 373 Score = 21.0 bits (42), Expect = 9.5 Identities = 10/40 (25%), Positives = 22/40 (55%) Frame = +3 Query: 48 KFLYILKWLMQNFSELSANAHLINFQNSK*RKRTKI*IYY 167 KF+ + L++ +L + +IN++N + R R + + Y Sbjct: 101 KFIEFINKLIEFDVKLQNVSLIINYENQRTRSRIHLFVRY 140 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 158,443 Number of Sequences: 336 Number of extensions: 3189 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18010165 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -