BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10k22 (687 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_33873| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_25528| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_53505| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_11502| Best HMM Match : PA (HMM E-Value=9.3) 28 6.2 >SB_33873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1362 Score = 30.3 bits (65), Expect = 1.5 Identities = 17/47 (36%), Positives = 26/47 (55%), Gaps = 3/47 (6%) Frame = +2 Query: 281 RSVNCVPVRTSKSRELRGSILYTDCF-CLRRNGLQYDCRR--SGCQG 412 +S NC ++ R+ + + Y CF CLR+N Y+CR S C+G Sbjct: 348 KSENCERFKSPGERK-KILVKYARCFRCLRKNYRSYECRSKDSNCKG 393 >SB_25528| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 32 Score = 28.3 bits (60), Expect = 6.2 Identities = 10/22 (45%), Positives = 17/22 (77%) Frame = -2 Query: 389 SRIEGRSDANKSNQYTKYYRVT 324 +R+E S AN +++YT+YY+ T Sbjct: 9 TRVENESAANATSRYTEYYKKT 30 >SB_53505| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 342 Score = 28.3 bits (60), Expect = 6.2 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = -1 Query: 132 LNFGNLLNVHLRKVH*NFASTILKCTKI 49 + FG+ LN + RK H N AST+ TK+ Sbjct: 12 IKFGSNLNFNKRKFHSNCASTVAPDTKL 39 >SB_11502| Best HMM Match : PA (HMM E-Value=9.3) Length = 511 Score = 28.3 bits (60), Expect = 6.2 Identities = 14/36 (38%), Positives = 20/36 (55%), Gaps = 2/36 (5%) Frame = +2 Query: 269 LKMKRSVNCVPVRTSKSRELRGSILYTDCF--CLRR 370 L + R C+ R SR+ RG +YT C+ CLR+ Sbjct: 395 LSLYRRHECL-FRVKTSRQCRGEFVYTSCYRCCLRK 429 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,198,903 Number of Sequences: 59808 Number of extensions: 391945 Number of successful extensions: 871 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 807 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 870 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1781448916 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -