BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10k20 (712 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_07_0101 + 41086735-41086809,41088634-41088721,41089727-410899... 30 2.1 09_02_0085 + 4111333-4111492,4114766-4116044,4116113-4116206,411... 28 6.4 >01_07_0101 + 41086735-41086809,41088634-41088721,41089727-41089923, 41090077-41090266,41090469-41090860,41091390-41091965 Length = 505 Score = 29.9 bits (64), Expect = 2.1 Identities = 12/27 (44%), Positives = 21/27 (77%) Frame = +1 Query: 586 LSKLGTDKKKTSGGLSERSDLVLAQRD 666 +S++G+DK ++ GGL + D+V+ QRD Sbjct: 49 VSRVGSDKSRSHGGLDSKKDVVI-QRD 74 >09_02_0085 + 4111333-4111492,4114766-4116044,4116113-4116206, 4116297-4116545 Length = 593 Score = 28.3 bits (60), Expect = 6.4 Identities = 11/37 (29%), Positives = 21/37 (56%) Frame = +1 Query: 199 SVNELPGSVPTVHKTGVSKSEHNIRQIVTVKDVSNAL 309 S LPG++P + TG+ S+ ++ + K+ S+ L Sbjct: 115 SATILPGALPAILYTGIDASKEQVQNVAFAKNPSDPL 151 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,707,349 Number of Sequences: 37544 Number of extensions: 334096 Number of successful extensions: 886 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 871 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 885 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1839213168 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -