BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10k20 (712 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chlor... 24 1.6 X91509-1|CAA62809.1| 103|Apis mellifera histone H4 protein. 23 2.2 DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated... 23 2.2 DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly pro... 23 3.8 DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channe... 21 8.7 >DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chloride channel protein. Length = 428 Score = 23.8 bits (49), Expect = 1.6 Identities = 13/35 (37%), Positives = 18/35 (51%), Gaps = 4/35 (11%) Frame = -3 Query: 500 TWVSFWILVTAC----TFGISATTTFSLIPLKHEA 408 +WVSFWI A T G+++ T S K +A Sbjct: 262 SWVSFWIKPEAAPARVTLGVTSLLTLSTQHAKSQA 296 >X91509-1|CAA62809.1| 103|Apis mellifera histone H4 protein. Length = 103 Score = 23.4 bits (48), Expect = 2.2 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = +1 Query: 232 VHKTGVSKSEHNIRQIVTVKDVSNALK 312 V + V+ +EH R+ VT DV ALK Sbjct: 66 VIRDAVTYTEHTKRKTVTAMDVVYALK 92 >DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 510 Score = 23.4 bits (48), Expect = 2.2 Identities = 11/26 (42%), Positives = 15/26 (57%), Gaps = 2/26 (7%) Frame = -3 Query: 500 TWVSFWI--LVTACTFGISATTTFSL 429 +WVSFWI T+ G+ TT +L Sbjct: 262 SWVSFWIHREATSDRVGLGITTVLTL 287 >DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly protein 9 protein. Length = 423 Score = 22.6 bits (46), Expect = 3.8 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = -2 Query: 489 VLDSGNSVYIWYISNDY 439 + + N+ YIW +SN Y Sbjct: 364 IYERQNNEYIWIVSNKY 380 >DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channel protein. Length = 489 Score = 21.4 bits (43), Expect = 8.7 Identities = 9/26 (34%), Positives = 14/26 (53%), Gaps = 2/26 (7%) Frame = -3 Query: 500 TWVSFWI--LVTACTFGISATTTFSL 429 +WVSFWI T+ + TT ++ Sbjct: 259 SWVSFWINHEATSARVALGITTVLTM 284 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 193,675 Number of Sequences: 438 Number of extensions: 3966 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21926700 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -