BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10k14 (636 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_02_0437 - 19084990-19087695 29 2.3 10_08_0366 - 17232010-17232061,17232546-17232601,17232692-172327... 29 4.1 12_01_0526 - 4171313-4171417,4171514-4171597,4171688-4171758,417... 28 5.4 07_01_1120 - 10338265-10338624,10338739-10338873,10339411-10340451 28 5.4 08_02_0443 - 17207513-17207665,17207674-17207762,17207923-17208319 27 9.4 02_05_0869 - 32344821-32344916,32345255-32345347,32345418-323455... 27 9.4 01_05_0744 - 24840172-24840327,24840476-24840564,24840856-248409... 27 9.4 01_01_1127 + 8930593-8932681,8932812-8933401 27 9.4 >12_02_0437 - 19084990-19087695 Length = 901 Score = 29.5 bits (63), Expect = 2.3 Identities = 15/28 (53%), Positives = 19/28 (67%) Frame = -2 Query: 467 LHTKINLKNSIIYVKNLSYLSPLREISI 384 LHT +K S V+NLSYL+ LR +SI Sbjct: 677 LHTLKEIKASKNLVQNLSYLTQLRSLSI 704 >10_08_0366 - 17232010-17232061,17232546-17232601,17232692-17232727, 17232861-17232941,17233060-17233131,17233394-17233465, 17233555-17233659,17233754-17233804,17234075-17234109, 17234692-17234736,17234940-17234973 Length = 212 Score = 28.7 bits (61), Expect = 4.1 Identities = 17/47 (36%), Positives = 26/47 (55%), Gaps = 2/47 (4%) Frame = +2 Query: 224 LEEINPDLAEAFNALPAGRSAGKDVEA--APEIPEHYSSKLNVPENP 358 L+EI D+A ++ P GR GK V+A + E+ E +L +NP Sbjct: 167 LDEIGVDIASQLSSAPKGRITGKKVQADESSELDE-LEKRLAALKNP 212 >12_01_0526 - 4171313-4171417,4171514-4171597,4171688-4171758, 4171814-4171891,4174482-4174569,4174659-4174850, 4174939-4175802 Length = 493 Score = 28.3 bits (60), Expect = 5.4 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = +2 Query: 227 EEINPDLAEAFNALPAGRSAGKDVEAAPEIPE 322 +++N DL + P GR KDVEAA P+ Sbjct: 200 KDLNVDLNSITGSGPGGRIVAKDVEAAAAAPK 231 >07_01_1120 - 10338265-10338624,10338739-10338873,10339411-10340451 Length = 511 Score = 28.3 bits (60), Expect = 5.4 Identities = 16/35 (45%), Positives = 18/35 (51%), Gaps = 1/35 (2%) Frame = +2 Query: 275 GRSAGKDVEAAP-EIPEHYSSKLNVPENPEIGDSR 376 GR A K EAAP P S+ +VP P GD R Sbjct: 18 GREARKSKEAAPPREPRRARSRSHVPPPPGAGDGR 52 >08_02_0443 - 17207513-17207665,17207674-17207762,17207923-17208319 Length = 212 Score = 27.5 bits (58), Expect = 9.4 Identities = 10/27 (37%), Positives = 18/27 (66%) Frame = +3 Query: 264 LCPPEEALVKMSKQPQKFPNTTHQNLM 344 +C ++A+ + SK P P+TT +NL+ Sbjct: 78 MCDEQDAVFQDSKAPDATPSTTEENLV 104 >02_05_0869 - 32344821-32344916,32345255-32345347,32345418-32345551, 32345863-32346013,32346337-32346407,32346683-32346828, 32347172-32347221,32347552-32347628,32347716-32347776, 32347859-32347912,32347999-32348058,32348491-32348624, 32349740-32350418 Length = 601 Score = 27.5 bits (58), Expect = 9.4 Identities = 14/63 (22%), Positives = 29/63 (46%), Gaps = 2/63 (3%) Frame = +2 Query: 173 PQAPGYVPVYIRSGDTPLEEINPDLAEAFNALPAGRSAGKDVEAAPEIPEHYSSKL--NV 346 P +VP + + P+E++ P N +P ++ +V+A P++ + K + Sbjct: 455 PDLADFVPSGVPNSAEPIEKVTPTNVPRQNDVPKEKTCLPEVKAKPKVQNKGAEKTQSKI 514 Query: 347 PEN 355 P N Sbjct: 515 PTN 517 >01_05_0744 - 24840172-24840327,24840476-24840564,24840856-24840928, 24841006-24841089,24841355-24841505,24842145-24842227, 24842358-24842504 Length = 260 Score = 27.5 bits (58), Expect = 9.4 Identities = 15/45 (33%), Positives = 21/45 (46%), Gaps = 1/45 (2%) Frame = +3 Query: 201 TSGAETRPSKKSIL-IWLKLSTLCPPEEALVKMSKQPQKFPNTTH 332 T G + P +K IWL+ T P E A + + K+P P H Sbjct: 147 TQGLDLIPQQKPFSGIWLQRKTPKPMEHANLNLCKEPSTSPLPKH 191 >01_01_1127 + 8930593-8932681,8932812-8933401 Length = 892 Score = 27.5 bits (58), Expect = 9.4 Identities = 14/51 (27%), Positives = 25/51 (49%) Frame = +3 Query: 207 GAETRPSKKSILIWLKLSTLCPPEEALVKMSKQPQKFPNTTHQNLMCPKTQ 359 G E P+ + + WLK L P+EA +++ ++ PN+ L K + Sbjct: 331 GCEECPTNEDV--WLKACRLASPDEAKAVIARGVKEIPNSVKLWLQAAKLE 379 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,974,158 Number of Sequences: 37544 Number of extensions: 284344 Number of successful extensions: 667 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 656 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 667 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1561213104 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -