BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10k12 (652 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g02650.1 68414.m00215 DNAJ heat shock N-terminal domain-conta... 28 4.7 At3g28610.1 68416.m03571 AAA-type ATPase family protein contains... 28 6.2 >At1g02650.1 68414.m00215 DNAJ heat shock N-terminal domain-containing protein contains Pfam profile PF00226: DnaJ domain Length = 513 Score = 28.3 bits (60), Expect = 4.7 Identities = 14/28 (50%), Positives = 20/28 (71%) Frame = -2 Query: 609 MLPSGNLSFEKKKKCCWSQSYLAKKLVA 526 +LPSG+ S + KC +S SYL KK++A Sbjct: 104 LLPSGSPSHDSSFKC-FSYSYLKKKVMA 130 >At3g28610.1 68416.m03571 AAA-type ATPase family protein contains Pfam profile: ATPase family PF00004 Length = 473 Score = 27.9 bits (59), Expect = 6.2 Identities = 13/35 (37%), Positives = 21/35 (60%), Gaps = 1/35 (2%) Frame = -3 Query: 221 FSHRISTSTMRYFLLNINQISITKRFS-KWLPYFN 120 F + + + +FL I QIS KRFS K++ +F+ Sbjct: 23 FPNHLKIAIKEFFLSTIQQISFAKRFSDKFINFFS 57 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,809,402 Number of Sequences: 28952 Number of extensions: 264596 Number of successful extensions: 463 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 461 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 463 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1354097952 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -