BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10k08 (324 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g69910.1 68414.m08045 protein kinase family protein contains ... 26 6.7 At4g39710.1 68417.m05620 immunophilin, putative / FKBP-type pept... 25 8.8 At1g66450.1 68414.m07549 DC1 domain-containing protein contains ... 25 8.8 >At1g69910.1 68414.m08045 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 636 Score = 25.8 bits (54), Expect = 6.7 Identities = 10/30 (33%), Positives = 14/30 (46%) Frame = -1 Query: 276 LNTDGCHRRHPRRYVSEFNISSCSTCKW*C 187 ++ C R R S F + +CS C W C Sbjct: 125 VSDSSCSRLSLLRPCSPFTLPNCSRCPWDC 154 >At4g39710.1 68417.m05620 immunophilin, putative / FKBP-type peptidyl-prolyl cis-trans isomerase, putative similar to FK506 binding protein 1 (GP:21535744) [Arabidopsis thaliana] Length = 217 Score = 25.4 bits (53), Expect = 8.8 Identities = 16/45 (35%), Positives = 26/45 (57%) Frame = +1 Query: 190 SPFTRAARRYVKFGNISTRVSSMTTISVKCNSDVLCK*KISVKKK 324 S +TR+ R + F + SS ++ S C+S C+ K+SVKK+ Sbjct: 11 SLYTRSFRPTIFFSS-----SSSSSFSCLCSSSSDCEPKLSVKKR 50 >At1g66450.1 68414.m07549 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 700 Score = 25.4 bits (53), Expect = 8.8 Identities = 11/28 (39%), Positives = 13/28 (46%) Frame = -1 Query: 216 SSCSTCKW*CTESRGRSMGRSKNRRVLH 133 +SCS C W CT R R +LH Sbjct: 482 NSCSACPWLCTTGFFYECDREGCRFILH 509 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 4,922,543 Number of Sequences: 28952 Number of extensions: 64412 Number of successful extensions: 136 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 133 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 136 length of database: 12,070,560 effective HSP length: 71 effective length of database: 10,014,968 effective search space used: 360538848 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -