BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10k07 (725 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 23 3.9 L10430-1|AAA27731.1| 150|Apis mellifera transposase protein. 22 6.8 DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. 22 6.8 AY155490-1|AAO12861.1| 342|Apis mellifera Ammar1 transposase pr... 22 6.8 AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. 22 6.8 AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 22 6.8 AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellif... 21 9.0 AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein ... 21 9.0 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 22.6 bits (46), Expect = 3.9 Identities = 10/33 (30%), Positives = 19/33 (57%) Frame = +3 Query: 516 TNNHRSSHSTSRDSLTLRATNVPISKLPSSPRS 614 TN + ++ + +++ T VPI+ LP+S S Sbjct: 833 TNVTTTINTPTTSVISMSGTTVPITSLPASSTS 865 >L10430-1|AAA27731.1| 150|Apis mellifera transposase protein. Length = 150 Score = 21.8 bits (44), Expect = 6.8 Identities = 7/15 (46%), Positives = 9/15 (60%) Frame = -1 Query: 386 EMWVLYGTAHQGRSW 342 E WV+Y + RSW Sbjct: 33 EKWVVYNNIKRKRSW 47 >DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. Length = 471 Score = 21.8 bits (44), Expect = 6.8 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = -3 Query: 204 FGITSGTTWLASKDFATVDIALVKTLKLTIVA 109 +GI++G A + A +ALV TL + IV+ Sbjct: 384 YGISAGLNRTAGQQAAYQLLALVITLGIAIVS 415 >AY155490-1|AAO12861.1| 342|Apis mellifera Ammar1 transposase protein. Length = 342 Score = 21.8 bits (44), Expect = 6.8 Identities = 7/15 (46%), Positives = 9/15 (60%) Frame = -1 Query: 386 EMWVLYGTAHQGRSW 342 E WV+Y + RSW Sbjct: 154 EKWVVYNNIKRKRSW 168 >AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. Length = 652 Score = 21.8 bits (44), Expect = 6.8 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = -3 Query: 228 TCNKAAGAFGITSGTTW 178 + NKA+ AFGI S T + Sbjct: 483 SANKASKAFGIPSSTLY 499 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 21.8 bits (44), Expect = 6.8 Identities = 10/43 (23%), Positives = 19/43 (44%) Frame = +3 Query: 435 TPAKLCPSTWALDLRKRQACTDTCSSCTNNHRSSHSTSRDSLT 563 +PA+ C ST + R Q T+N+ ++ + +T Sbjct: 746 SPAEQCASTTTITARSPQGSQGLLQCATSNYSTTRWPATSVIT 788 >AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellifera ORF for hypotheticalprotein. ). Length = 998 Score = 21.4 bits (43), Expect = 9.0 Identities = 11/31 (35%), Positives = 14/31 (45%) Frame = -2 Query: 343 GQSVVLSWLRVPFH*RLVFHLSWSQLITFFN 251 G S+ WLR +VF L L+ FN Sbjct: 583 GSSIKAMWLRRALASLMVFSLGLFLLLDMFN 613 >AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein protein. Length = 352 Score = 21.4 bits (43), Expect = 9.0 Identities = 9/31 (29%), Positives = 15/31 (48%) Frame = +2 Query: 293 EPSVKWDAEPGQYYTLAMTDPDAPSRKEPTF 385 +PS+ PG +Y A + D P + P + Sbjct: 53 DPSLLRQGVPGHHYGAAGSQQDMPYPRFPPY 83 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 213,453 Number of Sequences: 438 Number of extensions: 5036 Number of successful extensions: 14 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22535775 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -