BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10k06 (718 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. 24 1.1 L01615-1|AAA30095.1| 69|Tribolium castaneum zinc finger protei... 24 1.4 AJ307577-1|CAC84070.1| 301|Tribolium castaneum dachshund protein. 23 3.3 AJ606487-1|CAE55183.1| 203|Tribolium castaneum Giant protein pr... 21 7.6 >X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. Length = 524 Score = 24.2 bits (50), Expect = 1.1 Identities = 16/41 (39%), Positives = 20/41 (48%), Gaps = 2/41 (4%) Frame = +1 Query: 340 KCPKAKSKMLH-EY-LQPHVTALRMSAQCNYCDFKCELESM 456 KCP H EY L+ H + QCN CD+ C +SM Sbjct: 235 KCPFITEYKHHLEYHLRNHAGSKPF--QCNKCDYTCVNKSM 273 >L01615-1|AAA30095.1| 69|Tribolium castaneum zinc finger protein protein. Length = 69 Score = 23.8 bits (49), Expect = 1.4 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +1 Query: 415 QCNYCDFKCELESM 456 QCN CD+ C +SM Sbjct: 18 QCNKCDYTCVNKSM 31 >AJ307577-1|CAC84070.1| 301|Tribolium castaneum dachshund protein. Length = 301 Score = 22.6 bits (46), Expect = 3.3 Identities = 13/35 (37%), Positives = 16/35 (45%) Frame = +1 Query: 424 YCDFKCELESMKEEICVSMRKAKTDFKAYMRDPKN 528 Y D LE ++EE C R D KA P+N Sbjct: 170 YEDIVKHLERLREERCDPDRPLPLDQKARDLSPRN 204 >AJ606487-1|CAE55183.1| 203|Tribolium castaneum Giant protein protein. Length = 203 Score = 21.4 bits (43), Expect = 7.6 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = +1 Query: 484 KAKTDFKAYMRDPKNLELRHGVV 552 K+ FKAY++DP L L G+V Sbjct: 66 KSCRPFKAYIKDP--LTLAQGLV 86 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 168,292 Number of Sequences: 336 Number of extensions: 3582 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19051215 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -