BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10k06 (718 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine pr... 25 1.8 AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22... 25 1.8 DQ137801-1|AAZ78362.1| 622|Anopheles gambiae male-specific doub... 24 5.4 >AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine protease protein. Length = 1322 Score = 25.4 bits (53), Expect = 1.8 Identities = 10/35 (28%), Positives = 18/35 (51%) Frame = +1 Query: 220 PTVEAAKTEVPTKPPPMRLNELPLYDNPHQIYKDY 324 PT+ A + + P + PP + P + + QI D+ Sbjct: 391 PTIPAPQQQTPPRQPPATGDRAPAHPDVEQIDPDH 425 >AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22D protein. Length = 1322 Score = 25.4 bits (53), Expect = 1.8 Identities = 10/35 (28%), Positives = 18/35 (51%) Frame = +1 Query: 220 PTVEAAKTEVPTKPPPMRLNELPLYDNPHQIYKDY 324 PT+ A + + P + PP + P + + QI D+ Sbjct: 390 PTIPAPQQQTPPRQPPATGDRAPAHPDVEQIDPDH 424 >DQ137801-1|AAZ78362.1| 622|Anopheles gambiae male-specific doublesex protein protein. Length = 622 Score = 23.8 bits (49), Expect = 5.4 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +1 Query: 295 DNPHQIYKDYLEDLEKCPKA 354 DNP Q Y+ YLE + + K+ Sbjct: 420 DNPSQPYEAYLESVRRSKKS 439 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 745,649 Number of Sequences: 2352 Number of extensions: 14982 Number of successful extensions: 15 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 72765525 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -