BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10k06 (718 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase ... 25 0.54 DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase ... 25 0.54 U70841-1|AAC47455.1| 377|Apis mellifera ultraviolet sensitive o... 24 1.2 AF004168-1|AAC13417.1| 377|Apis mellifera blue-sensitive opsin ... 24 1.2 >DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase isoform B protein. Length = 931 Score = 25.4 bits (53), Expect = 0.54 Identities = 10/32 (31%), Positives = 18/32 (56%) Frame = -1 Query: 412 LTFLKQSREAASTHAASLIWLLDIFLDLPNSL 317 L F+ S + +STH + W + +++ NSL Sbjct: 487 LIFMSSSLQWSSTHTLDVAWRRKVTIEILNSL 518 >DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase isoform A protein. Length = 969 Score = 25.4 bits (53), Expect = 0.54 Identities = 10/32 (31%), Positives = 18/32 (56%) Frame = -1 Query: 412 LTFLKQSREAASTHAASLIWLLDIFLDLPNSL 317 L F+ S + +STH + W + +++ NSL Sbjct: 525 LIFMSSSLQWSSTHTLDVAWRRKVTIEILNSL 556 >U70841-1|AAC47455.1| 377|Apis mellifera ultraviolet sensitive opsin protein. Length = 377 Score = 24.2 bits (50), Expect = 1.2 Identities = 12/36 (33%), Positives = 17/36 (47%), Gaps = 1/36 (2%) Frame = -1 Query: 139 RLRT-RCLLDMAVNCLCPNWLAVFSWFWSRIFIAVP 35 R RT C +D +N + F+WFW F +P Sbjct: 154 RYRTISCPIDGRLNSKQAAVIIAFTWFWVTPFTVLP 189 >AF004168-1|AAC13417.1| 377|Apis mellifera blue-sensitive opsin protein. Length = 377 Score = 24.2 bits (50), Expect = 1.2 Identities = 12/36 (33%), Positives = 17/36 (47%), Gaps = 1/36 (2%) Frame = -1 Query: 139 RLRT-RCLLDMAVNCLCPNWLAVFSWFWSRIFIAVP 35 R RT C +D +N + F+WFW F +P Sbjct: 154 RYRTISCPIDGRLNSKQAAVIIAFTWFWVTPFTVLP 189 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 195,304 Number of Sequences: 438 Number of extensions: 3882 Number of successful extensions: 7 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22170330 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -