BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10k05 (612 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_1018 + 23326465-23326493,23326679-23327465 28 6.7 01_05_0600 + 23566223-23566355,23567752-23567855,23567958-235680... 27 8.9 >07_03_1018 + 23326465-23326493,23326679-23327465 Length = 271 Score = 27.9 bits (59), Expect = 6.7 Identities = 16/39 (41%), Positives = 21/39 (53%) Frame = -1 Query: 240 PNTTLHCLLLSVALHRR*MLNPLRHPLEPLVTINSLLRL 124 P+T LLL + H +LNPL H L L + +LL L Sbjct: 14 PSTEGLVLLLHESTHVARLLNPLTHQLTDLPPVTTLLDL 52 >01_05_0600 + 23566223-23566355,23567752-23567855,23567958-23568053, 23568134-23568253,23568543-23568710,23568921-23569012, 23569739-23569857,23570547-23570670,23570801-23570924, 23571291-23571359,23571470-23571561,23571645-23571722, 23571927-23571994,23572073-23572209 Length = 507 Score = 27.5 bits (58), Expect = 8.9 Identities = 15/40 (37%), Positives = 24/40 (60%) Frame = -2 Query: 443 PTHCARAICSDVPVVRSGCMQTGTILLSYGNSHDIFVRLV 324 PT AR++ + VVR G TG + + GNS+D+ +L+ Sbjct: 446 PTRPARSLSTLTRVVRRGAESTG--IEANGNSYDLSTKLL 483 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,050,958 Number of Sequences: 37544 Number of extensions: 299278 Number of successful extensions: 578 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 568 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 578 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1466594128 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -