BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10k04 (680 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF016414-4|AAG24021.2| 230|Caenorhabditis elegans Serpentine re... 31 0.58 AF016414-3|AAW88405.1| 329|Caenorhabditis elegans Serpentine re... 31 0.58 CU457741-1|CAM36342.1| 347|Caenorhabditis elegans Hypothetical ... 31 1.0 Z81029-1|CAB02697.1| 465|Caenorhabditis elegans Hypothetical pr... 29 4.1 U97005-12|AAB52289.1| 1121|Caenorhabditis elegans Hypothetical p... 28 7.1 >AF016414-4|AAG24021.2| 230|Caenorhabditis elegans Serpentine receptor, class h protein210, isoform a protein. Length = 230 Score = 31.5 bits (68), Expect = 0.58 Identities = 17/51 (33%), Positives = 24/51 (47%) Frame = +2 Query: 398 TLATISSKLWMRLGKTFVGLLELV*GSYKIEGVEISPCRLTRNTTLQPRLP 550 T SSK W R K F+G+L +V +Y I +P + + RLP Sbjct: 124 TFLASSSKGWTRFRKAFIGILHVVAWTYFIPFTLTTPDQAVAGPAILQRLP 174 >AF016414-3|AAW88405.1| 329|Caenorhabditis elegans Serpentine receptor, class h protein210, isoform b protein. Length = 329 Score = 31.5 bits (68), Expect = 0.58 Identities = 17/51 (33%), Positives = 24/51 (47%) Frame = +2 Query: 398 TLATISSKLWMRLGKTFVGLLELV*GSYKIEGVEISPCRLTRNTTLQPRLP 550 T SSK W R K F+G+L +V +Y I +P + + RLP Sbjct: 124 TFLASSSKGWTRFRKAFIGILHVVAWTYFIPFTLTTPDQAVAGPAILQRLP 174 >CU457741-1|CAM36342.1| 347|Caenorhabditis elegans Hypothetical protein C42C1.1 protein. Length = 347 Score = 30.7 bits (66), Expect = 1.0 Identities = 13/29 (44%), Positives = 19/29 (65%) Frame = +1 Query: 67 FLKVFSKTRCVMNKLNIKLIRKFSDSCQE 153 FL V S T C+ N LN K+ +K+ +CQ+ Sbjct: 168 FLLVLSATSCLGNMLNYKINQKYYRACQQ 196 >Z81029-1|CAB02697.1| 465|Caenorhabditis elegans Hypothetical protein C01A2.1 protein. Length = 465 Score = 28.7 bits (61), Expect = 4.1 Identities = 26/69 (37%), Positives = 38/69 (55%), Gaps = 6/69 (8%) Frame = +1 Query: 133 FSDSCQEVSG---EINQKLDS--SKKGLVLGVYQCGKKLELTPVGQELDQKS-GGKILQH 294 F++ C E++ EIN+ D ++ G+ +G Y K L + Q DQKS GKI + Sbjct: 132 FTNECDEIANVLREINRLEDYGLARNGIRVG-YLEQMKFNLEEMFQ--DQKSMKGKITLN 188 Query: 295 LNELSERMK 321 + ELSE MK Sbjct: 189 IGELSETMK 197 >U97005-12|AAB52289.1| 1121|Caenorhabditis elegans Hypothetical protein F19F10.11a protein. Length = 1121 Score = 27.9 bits (59), Expect = 7.1 Identities = 17/71 (23%), Positives = 34/71 (47%) Frame = +1 Query: 91 RCVMNKLNIKLIRKFSDSCQEVSGEINQKLDSSKKGLVLGVYQCGKKLELTPVGQELDQK 270 +C+ K +K ++K C +++ + S++ L + +KLELT + + K Sbjct: 989 KCISYKFTVKYLQKTCAMC-DLNFYRKDMMSISREAWALAQWIDCRKLELTDSWKHKNIK 1047 Query: 271 SGGKILQHLNE 303 GK+ + L E Sbjct: 1048 DTGKLYEALKE 1058 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,125,300 Number of Sequences: 27780 Number of extensions: 245385 Number of successful extensions: 644 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 637 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 644 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1550199966 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -