BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10j24 (616 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 30 0.021 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 29 0.027 AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor ... 22 5.5 EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage prot... 21 9.6 AY647436-1|AAU81605.1| 567|Apis mellifera juvenile hormone este... 21 9.6 AB083009-1|BAC54130.1| 567|Apis mellifera esterase protein. 21 9.6 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 29.9 bits (64), Expect = 0.021 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = -1 Query: 304 RRVSAVCGSDGQTYRSLCKLRRQAC 230 RR VC S+G+ Y + C+L R AC Sbjct: 112 RRHRPVCASNGKIYANHCELHRAAC 136 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 29.5 bits (63), Expect = 0.027 Identities = 18/55 (32%), Positives = 28/55 (50%) Frame = -3 Query: 305 PQSERGVRQRRADLPLAVQITPTSLSQAS*ALGRRLPWTLLKF*APNRT*YLVKI 141 PQS+ R A+ P++VQ+ P + S + AL P L ++ P R LV + Sbjct: 445 PQSDSSSSSRSAESPMSVQVDPMAASVVAAALTGTYPTLLPQWCLPPREAPLVGV 499 >AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor A isoform protein. Length = 567 Score = 21.8 bits (44), Expect = 5.5 Identities = 11/35 (31%), Positives = 14/35 (40%) Frame = +3 Query: 291 ALTLRHDAAQTHLARPPLTTQRRPAPQDIPAHDSV 395 +LTL HLA T P P +P +V Sbjct: 29 SLTLVKAETPEHLAGTSTTAAATPTPPSVPVGSAV 63 >EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage protein protein. Length = 1010 Score = 21.0 bits (42), Expect = 9.6 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = -1 Query: 238 QACRKPAKHLVVDYHGHY*NFEHQ 167 QA R +L YHG Y N + Q Sbjct: 712 QAVRNYYANLYTKYHGQYPNTQIQ 735 >AY647436-1|AAU81605.1| 567|Apis mellifera juvenile hormone esterase protein. Length = 567 Score = 21.0 bits (42), Expect = 9.6 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +3 Query: 330 ARPPLTTQRRPAPQDIPA 383 A PP+ R APQ IPA Sbjct: 54 ALPPVGKFRFKAPQKIPA 71 >AB083009-1|BAC54130.1| 567|Apis mellifera esterase protein. Length = 567 Score = 21.0 bits (42), Expect = 9.6 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +3 Query: 330 ARPPLTTQRRPAPQDIPA 383 A PP+ R APQ IPA Sbjct: 54 ALPPVGKFRFKAPQKIPA 71 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 154,956 Number of Sequences: 438 Number of extensions: 3117 Number of successful extensions: 8 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18215697 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -